TkA02G341890 | RubberDandelionOmics

Gene overview

TkA02G341890

Reference: TK1151 Chr: Chr02 Coordinates: 86840815-86842778 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

691 bp · TkA02G341890|TK1151|cDNA

AACCGGACCAATTTCAACCAAACCGATTTTAAAATCAGATGGAATTGTTTTAAGTTTGGATCGGTTTTTTGTCCACCCTACTCATGGCCATATATAGTCTTAGCCCAAATATAATTGGGTCAAGTTGGGTTTATGGGTTTATTTGGGCAGCTACATATCTAAATGGGACGGGTCATGTTCGCCCAAAACAGTCCAAATCCTTTTTTTTCAGCACTCAATTTACGGCATTCACTCTCGATCATCGTTTTCTTCGCTCAACT...

CDS

Download CDS FASTA

387 bp · TkA02G341890|TK1151|CDS

ATGGCTGGCCATGATGAATCAAGCGTGTCTGGAAAGAAATCCAATGAAAATGAAGTGCCAACTTTTAATGCCGAAAATATGCAAAGCAACATGAAAGTGGTATACTACAGCCGAACATTCATGTCTATTATTGGTGGAGTGATTGCTGGAATATTGGGATTTACGGGTCTCATGGGATTTGTCGTCTATTTACTTGTCATGGCCATAACTTCCGTTTGTCTAACAGCCAAGGCAGGTTTTTCCATCCACACATATTTTGA...

Protein

Download Protein FASTA

128 aa · TkA02G341890|TK1151|PROTEIN

MAGHDESSVSGKKSNENEVPTFNAENMQSNMKVVYYSRTFMSIIGGVIAGILGFTGLMGFVVYLLVMAITSVCLTAKAGFSIHTYFDTWNRVLLDGFFGGFLSFVLFWTYPFICFFFVFTFSPLKYIF

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G341890`
TK1151 ID	TkA02G341890
OH-1004 ID	LXL04_022586
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	81.300
Protein coverage (%)	TK1151 87.500 / OH-1004 82.963 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA02G341890`
Location	Chr02:86840815-86842778 (-)
Description	Similar to Emc6: ER membrane protein complex subunit 6
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_022586` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0000045 autophagosome assembly Biological Process GO:0045050 protein insertion into ER membrane by stop-transfer membrane-anchor sequence Biological Process GO:0071816 tail-anchored membrane protein insertion into ER membrane Biological Process GO:0005789 endoplasmic reticulum membrane Cellular Component GO:0016020 membrane Cellular Component GO:0072546 EMC complex Cellular Component GO:1903349 omegasome membrane Cellular Component GO:0032977 membrane insertase activity Molecular Function
KEGG gene cross-reference	ddi:DDB_G0280399 dre:337220 hsa:83460 mmu:66048 xtr:448052 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.730

Rank 1 · TkA02G341890 · TK1151

Golgi apparatus0.205

Rank 2 · TkA02G341890 · TK1151

Cytoplasm0.095

Rank 3 · TkA02G341890 · TK1151

Nucleus0.081

Rank 4 · TkA02G341890 · TK1151

Cell membrane0.052

Rank 5 · TkA02G341890 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01102Glycophorin_A7-62 aa

PF14015DUF423125-89 aa

PF07019EMC633-110 aa

PF23906DUF724836-70 aa

PF31149TA_Actino43-67 aa

PF31149TA_Actino99-118 aa

PF23906DUF7248111-111 aa

PF07019EMC6112-124 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G341890	`PF01102`	Glycophorin_A	7	62	0.27	12.2
TkA02G341890	`PF14015`	DUF4231	25	89	0.15	13.3
TkA02G341890	`PF07019`	EMC6	33	110	1.1e-19	71.4
TkA02G341890	`PF23906`	DUF7248	36	70	0.0036	18.1
TkA02G341890	`PF31149`	TA_Actino	43	67	2.0	9.1
TkA02G341890	`PF31149`	TA_Actino	99	118	2.0	9.1
TkA02G341890	`PF23906`	DUF7248	111	111	0.0036	18.1
TkA02G341890	`PF07019`	EMC6	112	124	1.1e-19	71.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card