TkA02G340670 | RubberDandelionOmics

Gene overview

TkA02G340670

Reference: TK1151 Chr: Chr02 Coordinates: 86524923-86529830 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1704 bp · TkA02G340670|TK1151|cDNA

ATGTGGGATGGAATACAGGAGAAGGTCAACATAATCAATGTGTATGCACCTAATGATACGGGAGAAAGGAAACTTTTGTGGTCGAAACTACTGGAAATGAAGAACACTATGCCTGGGATTTGGCTTATCATGGGCGATTTTAATGAGGTAAGGTGCAGGGAGGACCGCTTCTCTCGATGGGTATGTGTCTCAAGCATGAATGAGTTCAATAGATTCATTAGTTGTAACATCCCGTGGAATAATGCTGCAGTCACTGTGCT...

CDS

Download CDS FASTA

1704 bp · TkA02G340670|TK1151|CDS

ATGTGGGATGGAATACAGGAGAAGGTCAACATAATCAATGTGTATGCACCTAATGATACGGGAGAAAGGAAACTTTTGTGGTCGAAACTACTGGAAATGAAGAACACTATGCCTGGGATTTGGCTTATCATGGGCGATTTTAATGAGGTAAGGTGCAGGGAGGACCGCTTCTCTCGATGGGTATGTGTCTCAAGCATGAATGAGTTCAATAGATTCATTAGTTGTAACATCCCGTGGAATAATGCTGCAGTCACTGTGCT...

Protein

Download Protein FASTA

567 aa · TkA02G340670|TK1151|PROTEIN

MWDGIQEKVNIINVYAPNDTGERKLLWSKLLEMKNTMPGIWLIMGDFNEVRCREDRFSRWVCVSSMNEFNRFISCNIPWNNAAVTVLPRKYSDHNPVVLVTETVDFGPKPFRFFNSWFMLEGLTEIVTNSWAKEVNSHDACKLLLTKLQQLKADIRKWRQRLRGKEEECRRRFIDLEMLKKQDLKQKAKLKWDIEGDENSTFFHGMINANRTNNKINGLLIDGNWERCPRKLKEEALRFFAENFEEKQVDRPKFMNKNFS...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G340670`
TK1151 ID	TkA02G340670
OH-1004 ID	LXL04_014780
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	40.000
Protein coverage (%)	TK1151 99.295 / OH-1004 26.370 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G340670

Location Chr02:86524923-86529830 (-)

Description Similar to Transposon TX1 uncharacterized 149 kDa protein

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`UniProt: P92555`	Uncharacterized mitochondrial protein AtMg01250.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_014780 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000724 double-strand break repair via homologous recombination Biological Process

GO:0006310 DNA recombination Biological Process

GO:0006974 DNA damage response Biological Process

GO:0010212 response to ionizing radiation Biological Process

GO:0016567 protein ubiquitination Biological Process

GO:0031297 replication fork processing Biological Process

GO:0031571 mitotic G1 DNA damage checkpoint signaling Biological Process

GO:0032197 retrotransposition Biological Process

GO:0036297 interstrand cross-link repair Biological Process

GO:0090304 nucleic acid metabolic process Biological Process

GO:2000001 regulation of DNA damage checkpoint Biological Process

GO:0005634 nucleus Cellular Component

KEGG gene cross-reference

hsa:55159

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.712

Rank 1 · TkA02G340670 · TK1151

Nucleus0.306

Rank 2 · TkA02G340670 · TK1151

Cell membrane0.074

Rank 3 · TkA02G340670 · TK1151

Endoplasmic reticulum0.042

Rank 4 · TkA02G340670 · TK1151

Plastid0.032

Rank 5 · TkA02G340670 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03372Exo_endo_phos15-51 aa

PF00078RVT_1339-374 aa

PF00078RVT_1379-514 aa

PF14409Herpeto_peptide477-501 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G340670	`PF03372`	Exo_endo_phos	15	51	0.14	12.7
TkA02G340670	`PF00078`	RVT_1	339	374	7.7e-16	59.3
TkA02G340670	`PF00078`	RVT_1	379	514	7.7e-16	59.3
TkA02G340670	`PF14409`	Herpeto_peptide	477	501	0.16	12.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`P92555`	Arabidopsis thaliana	sp\|P92555\|M1250_ARATH Uncharacterized mitochondrial protein AtMg01250	35.200%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card