TkA02G337040 | RubberDandelionOmics

Gene overview

TkA02G337040

Reference: TK1151 Chr: Chr02 Coordinates: 85586044-85586488 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

312 bp · TkA02G337040|TK1151|cDNA

ATGGCCTTCCCCGATGCGATTCACGCATTTAAACCAAACCCTAAATCGCACATCCAGGAAGACAGGAGAATTCTCGATTTCCTATCCCACCATCCGGAAAGCTTAAACACCATGAGATTCTGGCTCGATGATGTTGGCATCCTCTTAATTTTTTTTATAATCATCTTAGGTCTGTCAAATTCAATCATGGGTTTCTATTTGGGAAATCCAACACACGAACACAAAGGGTTTGCTAAATTTATCTTACATTCTGGCCTGTT...

CDS

Download CDS FASTA

312 bp · TkA02G337040|TK1151|CDS

ATGGCCTTCCCCGATGCGATTCACGCATTTAAACCAAACCCTAAATCGCACATCCAGGAAGACAGGAGAATTCTCGATTTCCTATCCCACCATCCGGAAAGCTTAAACACCATGAGATTCTGGCTCGATGATGTTGGCATCCTCTTAATTTTTTTTATAATCATCTTAGGTCTGTCAAATTCAATCATGGGTTTCTATTTGGGAAATCCAACACACGAACACAAAGGGTTTGCTAAATTTATCTTACATTCTGGCCTGTT...

Protein

Download Protein FASTA

103 aa · TkA02G337040|TK1151|PROTEIN

MAFPDAIHAFKPNPKSHIQEDRRILDFLSHHPESLNTMRFWLDDVGILLIFFIIILGLSNSIMGFYLGNPTHEHKGFAKFILHSGLLIAIIFNLGFQTISKNE

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G337040`
TK1151 ID	TkA02G337040
OH-1004 ID	LXL04_015400
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G337040

Location Chr02:85586044-85586488 (-)

Description Similar to CAT2: Catalase isozyme 2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g35090`	Catalyzes the degradation of hydrogen peroxide (H(2)O(2)) generated by peroxisomal oxidases to water and oxygen, thereby protecting cells from the toxic effects of hydrogen peroxide.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`UniProt: P0C549`	Occurs in almost all aerobically respiring organisms and serves to protect cells from the toxic effects of hydrogen peroxide.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_015400 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006979 response to oxidative stress Biological Process

GO:0007623 circadian rhythm Biological Process

GO:0009408 response to heat Biological Process

GO:0009414 response to water deprivation Biological Process

GO:0009416 response to light stimulus Biological Process

GO:0009617 response to bacterium Biological Process

GO:0009737 response to abscisic acid Biological Process

GO:0042542 response to hydrogen peroxide Biological Process

GO:0042744 hydrogen peroxide catabolic process Biological Process

GO:1902074 response to salt Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0005777 peroxisome Cellular Component

KEGG gene cross-reference

dosa:Os02g0115700

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Mitochondrion0.221

Rank 1 · TkA02G337040 · TK1151

Endoplasmic reticulum0.206

Rank 2 · TkA02G337040 · TK1151

Plastid0.184

Rank 3 · TkA02G337040 · TK1151

Cytoplasm0.126

Rank 4 · TkA02G337040 · TK1151

Golgi apparatus0.104

Rank 5 · TkA02G337040 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00199Catalase1-47 aa

PF04834Adeno_E3_14_522-59 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G337040	`PF00199`	Catalase	1	47	8.6e-08	32.4
TkA02G337040	`PF04834`	Adeno_E3_14_5	22	59	0.054	14.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`P25819`	Arabidopsis thaliana	sp\|P25819\|CATA2_ARATH Catalase-2	72.300%	Swiss-Prot	Low
`P0C549`	Oryza sativa subsp. indica	sp\|P0C549\|CATA1_ORYSI Catalase isozyme A	70.200%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card