Gene Card
Gene overview
cDNA / CDS / Protein Sequences
312 bp · LXL04_015400|LXL04_015400|OH1004|cDNA
ATGGCCTTCCCCGATGCGATTCACGCATTTAAACCAAACCCTAAATCGCACATCCAGGAAGACAGGAGAATTCTCGATTTCCTATCCCACCATCCGGAAAGCTTAAACACCATGAGATTCTGGCTCGATGATGTTGGCATcctcttaattttttttataatcatcTTAGGTCTGTCAAATTCAATCATGGGTTTCTATTTGGGAAATCCAACACACGAACACAAAGGGTTTGCTAAATTTATCTTACATTCTGGCCTGTT...
312 bp · LXL04_015400|LXL04_015400|OH1004|CDS
ATGGCCTTCCCCGATGCGATTCACGCATTTAAACCAAACCCTAAATCGCACATCCAGGAAGACAGGAGAATTCTCGATTTCCTATCCCACCATCCGGAAAGCTTAAACACCATGAGATTCTGGCTCGATGATGTTGGCATCCTCTTAATTTTTTTTATAATCATCTTAGGTCTGTCAAATTCAATCATGGGTTTCTATTTGGGAAATCCAACACACGAACACAAAGGGTTTGCTAAATTTATCTTACATTCTGGCCTGTT...
Protein
Download Protein FASTA103 aa · LXL04_015400|LXL04_015400|OH1004|PROTEIN
MAFPDAIHAFKPNPKSHIQEDRRILDFLSHHPESLNTMRFWLDDVGILLIFFIIILGLSNSIMGFYLGNPTHEHKGFAKFILHSGLLIAIIFNLGFQTISKNE
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | LXL04_015400 |
|---|---|
| Source version | OH-1004 / GCA_047496595.1_OSU_TarKok_2.0 |
SNP / Indel variants and carrier samplesCRA009020 · OH-1004
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | LXL04_015400 | |||||||||
|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr03:70767122-70767566 (+) | |||||||||
| Description | Similar to CAT2: Catalase isozyme 2 | |||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene ArabidopsisNo hit for this species in the current source table. Rice
| |||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | |||||||||
| GO annotations (OH1004 source) | GO:0006979 response to oxidative stress Biological Process GO:0007623 circadian rhythm Biological Process GO:0009408 response to heat Biological Process GO:0009414 response to water deprivation Biological Process GO:0009416 response to light stimulus Biological Process GO:0009617 response to bacterium Biological Process GO:0009737 response to abscisic acid Biological Process GO:0042542 response to hydrogen peroxide Biological Process GO:0042744 hydrogen peroxide catabolic process Biological Process GO:1902074 response to salt Biological Process GO:0005737 cytoplasm Cellular Component GO:0005777 peroxisome Cellular Component | |||||||||
| KEGG gene cross-reference | dosa:Os02g0115700 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF00199.25Catalase1-47 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| LXL04_015400 | PF00199.25 | Catalase | 1 | 47 | 8.6e-08 | 32.4 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.