RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkA02G334740
Reference: TK1151 Chr: Chr02 Coordinates: 84936141-84942696 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

1221 bp · TkA02G334740|TK1151|cDNA

CTCATGCATACCATCTTCCCCCTCTTCATTCCCCCACCCCTATTTCTTTTGCTTTCACATCCTCAAACACATCCACAAACACCTTAATTTGTGGAAATGGGAAGAACACCTTGTTGTGAAAAGGAAGGGATACGAAGAGGGAGGTGGACTGCTGAAGAAGATGAAACATTGGTCAAATACATTCAACACAATGGTGAAGGTTCTTGGAGGTCTTTGCCCAAAAATGCAGGTTTGTCAAGGTGTGGAAAGAGTTGCAGATT...

CDS

Download CDS FASTA

627 bp · TkA02G334740|TK1151|CDS

ATGTACAGATATTTCCGAGGTAAAGATGACTTGGCACTAAACTCGATCAAGATAACGGACGTAATCCATGCAAAGCCAAAAATAGGTCGCGTAAGCCGTTGCATGGCCAAAAAGTATAACAAGAATAGGGTGGCTACTGACATCAAATCAACACCAAGACCTTCCAACAATAAACTAGCCCCACGAACAATTATAAATAAAGACAAAACAGACGATCATGGAATTGGAAGCTATTCAGTTCCTTCGAAGAAAATTGTGGT...

Protein

Download Protein FASTA

208 aa · TkA02G334740|TK1151|PROTEIN

MYRYFRGKDDLALNSIKITDVIHAKPKIGRVSRCMAKKYNKNRVATDIKSTPRPSNNKLAPRTIINKDKTDDHGIGSYSVPSKKIVVTEDNKVAEIEWNFQEVRENQELGPNEFCFQDDEMMDITRYLGSGVLSIHDEEQAGKILADMSVEFAKMNETENEFWSLNSSETVGFYADGDHMELGCVGQDDGGDDMLLWLWDDDDRTGLL

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkA02G334740
TK1151 IDTkA02G334740
OH-1004 IDLXL04_015424
Relationship / confidenceMulti Source To Oh1004 / Complex relationship
Protein identity (%)98.500
Protein coverage (%)TK1151 97.596 / OH-1004 62.848
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkA02G334740
LocationChr02:84936141-84942696 (-)
DescriptionSimilar to MYB12: Transcription factor MYB12
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

No hit for this species in the current source table.

Rice

No hit for this species in the current source table.

Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_015424 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)
GO:0006351 DNA-templated transcription Biological Process
GO:0006355 regulation of DNA-templated transcription Biological Process
GO:0006950 response to stress Biological Process
GO:0008285 negative regulation of cell population proliferation Biological Process
GO:0009416 response to light stimulus Biological Process
GO:0009651 response to salt stress Biological Process
GO:0009723 response to ethylene Biological Process
GO:0009733 response to auxin Biological Process
GO:0009813 flavonoid biosynthetic process Biological Process
GO:0010224 response to UV-B Biological Process
GO:0043477 pigment biosynthetic process involved in pigment accumulation Biological Process
GO:0043480 pigment accumulation in tissues Biological Process
KEGG gene cross-reference
ath:AT2G47460
ath:AT3G62610
ath:AT5G49330
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.952
Rank 1 · TkA02G334740 · TK1151
Cytoplasm0.112
Rank 2 · TkA02G334740 · TK1151
Cell membrane0.040
Rank 3 · TkA02G334740 · TK1151
Endoplasmic reticulum0.029
Rank 4 · TkA02G334740 · TK1151
Plastid0.013
Rank 5 · TkA02G334740 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

No result was found for this query.

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser