TkA02G330450 | RubberDandelionOmics

Gene overview

TkA02G330450

Reference: TK1151 Chr: Chr02 Coordinates: 83819012-83820826 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1773 bp · TkA02G330450|TK1151|cDNA

ATGTTTGAAAATTGTAAAGTTTTATCGGATACATTTAGACTAAGATGGACTTTGAACGAAGACAAGAATCTGATCGATATAGGTTTAGAGGGTGCAATCGGAATTCAGAATTACATGGCATTTGGGTGGACCGAACCTAACCGCGAACACGATCATATGCTTAATGCTGACGTGGCATTCACTGGTTTTACCGAAGAAGGGGTCCCATTTGCAGATGATTATTACATCACCAAATACAGTGAATGTATAAAAAACGAAAA...

CDS

Download CDS FASTA

1773 bp · TkA02G330450|TK1151|CDS

ATGTTTGAAAATTGTAAAGTTTTATCGGATACATTTAGACTAAGATGGACTTTGAACGAAGACAAGAATCTGATCGATATAGGTTTAGAGGGTGCAATCGGAATTCAGAATTACATGGCATTTGGGTGGACCGAACCTAACCGCGAACACGATCATATGCTTAATGCTGACGTGGCATTCACTGGTTTTACCGAAGAAGGGGTCCCATTTGCAGATGATTATTACATCACCAAATACAGTGAATGTATAAAAAACGAAAA...

Protein

Download Protein FASTA

590 aa · TkA02G330450|TK1151|PROTEIN

MFENCKVLSDTFRLRWTLNEDKNLIDIGLEGAIGIQNYMAFGWTEPNREHDHMLNADVAFTGFTEEGVPFADDYYITKYSECIKNENKQFEGVCPDISISNSNSVNNTNLVYAHRKDGVSFIRYQRPLKSTDKKYDWDIEVNSERTCIWALGLIKPPDSIRPFYLPQNHGKTFGHVHINVSVKVNDCLGPLNAEVKEDQELVIADKKEPLVVTSGPSLHYPNPPNPSKVLYINKKETPVLRVERGVPVKFSIQAGHDVAF...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G330450`
TK1151 ID	TkA02G330450
OH-1004 ID	LXL04_015452
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	95.700
Protein coverage (%)	TK1151 99.153 / OH-1004 65.969 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G330450

Location Chr02:83819012-83820826 (-)

Description Similar to At5g54830: Cytochrome b561, DM13 and DOMON domain-containing protein At5g54830

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g54830`	May act as a catecholamine-responsive trans-membrane electron transporter.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_015452 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006879 intracellular iron ion homeostasis Biological Process

GO:0006997 nucleus organization Biological Process

GO:0051225 spindle assembly Biological Process

GO:0051301 cell division Biological Process

GO:0051321 meiotic cell cycle Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005700 polytene chromosome Cellular Component

GO:0005730 nucleolus Cellular Component

GO:0005768 endosome Cellular Component

GO:0005789 endoplasmic reticulum membrane Cellular Component

GO:0005794 Golgi apparatus Cellular Component

KEGG gene cross-reference

ath:AT3G61750

ath:AT5G54830

ddi:DDB_G0279437

dme:Dmel_CG43161

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.495

Rank 1 · TkA02G330450 · TK1151

Cytoplasm0.170

Rank 2 · TkA02G330450 · TK1151

Lysosome / Vacuole0.165

Rank 3 · TkA02G330450 · TK1151

Endoplasmic reticulum0.125

Rank 4 · TkA02G330450 · TK1151

Golgi apparatus0.111

Rank 5 · TkA02G330450 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03351DOMON10-152 aa

PF16010CDH-cyt99-181 aa

PF25489At5g54830202-327 aa

PF03351DOMON341-466 aa

PF16010CDH-cyt355-421 aa

PF10348DUF2427494-563 aa

PF03188Cytochrom_B561509-587 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G330450	`PF03351`	DOMON	10	152	1.5e-40	139.0
TkA02G330450	`PF16010`	CDH-cyt	99	181	0.0038	17.7
TkA02G330450	`PF25489`	At5g54830	202	327	1.4e-68	229.4
TkA02G330450	`PF03351`	DOMON	341	466	1.5e-40	139.0
TkA02G330450	`PF16010`	CDH-cyt	355	421	0.0038	17.7
TkA02G330450	`PF10348`	DUF2427	494	563	0.036	14.6
TkA02G330450	`PF03188`	Cytochrom_B561	509	587	0.0034	18.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FFU6`	Arabidopsis thaliana	sp\|Q9FFU6\|B561A_ARATH Cytochrome b561, DM13 and DOMON domain-containing protein At5g54830	65.900%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card