TkA02G327550 | RubberDandelionOmics

Gene overview

TkA02G327550

Reference: TK1151 Chr: Chr02 Coordinates: 83100832-83103205 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1678 bp · TkA02G327550|TK1151|cDNA

GGCTTAAAGAACCTGTGGGCAATGCCGCTTGTAACTAAGGCAACATGGCGGTTATTTATCGCCGGTATATTAAAACGACTTTCCATCACTCCCAGATTCGTCAACCATGTCTTCTCTCAGGCGATCGACTCCCTCCATCCACCGCCAAATCCGCTCAATATCATCTACACCGCCTTCATTGATCGCTACATCAATCACCACCGCCTCCCCCGATTCTGATAACAGAAACCCTAGTTTGCTGCGATGGCTTTCCGCCGTCG...

CDS

Download CDS FASTA

1353 bp · TkA02G327550|TK1151|CDS

ATGTCTTCTCTCAGGCGATCGACTCCCTCCATCCACCGCCAAATCCGCTCAATATCATCTACACCGCCTTCATTGATCGCTACATCAATCACCACCGCCTCCCCCGATTCTGATAACAGAAACCCTAGTTTGCTGCGATGGCTTTCCGCCGTCGTCGCAGGCACCGGCGTGGGGATGTCTCTTTACTGGTGTTCACATTCCTTATCGTCTACATACGCGGAGAAAACAGCTACGGGTTTTGCTGATTGGATGACCGCAAC...

Protein

Download Protein FASTA

450 aa · TkA02G327550|TK1151|PROTEIN

MSSLRRSTPSIHRQIRSISSTPPSLIATSITTASPDSDNRNPSLLRWLSAVVAGTGVGMSLYWCSHSLSSTYAEKTATGFADWMTATADRIKELYESQPLSSSNFFIRDALRRRIFFNYEKRLRTLSPPAKVFEYFASVRNSKGESLMTPGDLMRAIVPVFPPSESNLVREGSLRGERRPGELHCDPSEFFMLFDVNNDGLISFKEYIFFVTLLSIPESSFSVAFKMFDIDNDGEIDREEFKKVMALMRGHNRQGHYFHK...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G327550`
TK1151 ID	TkA02G327550
OH-1004 ID	LXL04_015476
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.300
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G327550

Location Chr02:83100832-83103205 (-)

Description Similar to MICU: Calcium uptake protein, mitochondrial

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g32060`	Calcium-binding protein maintaining matrix calcium levels at low concentration.	The EF-Hand Ca2+ Binding Protein MICU Choreographs Mitochondrial Ca2+ Dynamics in Arabidopsis.2015 · DOI: 10.1105/tpc.15.00509

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_015476 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006816 calcium ion transport Biological Process

GO:0006851 mitochondrial calcium ion transmembrane transport Biological Process

GO:0036444 calcium import into the mitochondrion Biological Process

GO:0051260 protein homooligomerization Biological Process

GO:0051560 mitochondrial calcium ion homeostasis Biological Process

GO:0051561 positive regulation of mitochondrial calcium ion concentration Biological Process

GO:0051562 negative regulation of mitochondrial calcium ion concentration Biological Process

GO:0070509 calcium ion import Biological Process

GO:0071277 cellular response to calcium ion Biological Process

GO:0072732 cellular response to calcium ion starvation Biological Process

GO:1900069 regulation of cellular hyperosmotic salinity response Biological Process

GO:1903852 positive regulation of cristae formation Biological Process

KEGG gene cross-reference

ath:AT4G32060

bta:507899

mmu:216001

rno:365567

xtr:100127574

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Mitochondrion0.861

Rank 1 · TkA02G327550 · TK1151

Cytoplasm0.072

Rank 2 · TkA02G327550 · TK1151

Plastid0.056

Rank 3 · TkA02G327550 · TK1151

Nucleus0.056

Rank 4 · TkA02G327550 · TK1151

Cell membrane0.035

Rank 5 · TkA02G327550 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF11282DUF308245-77 aa

PF10591SPARC_Ca_bdg77-98 aa

PF11282DUF308277-108 aa

PF30624EF_SSP120186-206 aa

PF10591SPARC_Ca_bdg188-208 aa

PF00036EF-hand_1189-212 aa

PF13405EF-hand_6189-209 aa

PF23564EF-hand_FSTL1189-212 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G327550	`PF11282`	DUF3082	45	77	0.42	11.6
TkA02G327550	`PF10591`	SPARC_Ca_bdg	77	98	0.022	15.8
TkA02G327550	`PF11282`	DUF3082	77	108	0.42	11.6
TkA02G327550	`PF30624`	EF_SSP120	186	206	0.0038	18.6
TkA02G327550	`PF10591`	SPARC_Ca_bdg	188	208	0.022	15.8
TkA02G327550	`PF00036`	EF-hand_1	189	212	1.4e-22	78.2
TkA02G327550	`PF13405`	EF-hand_6	189	209	3.6e-20	70.4
TkA02G327550	`PF23564`	EF-hand_FSTL1	189	212	2.8e-05	25.2
TkA02G327550	`PF13202`	EF-hand_5	190	210	3.2e-18	65.0
TkA02G327550	`PF13499`	EF-hand_7	190	245	3.7e-17	63.1
TkA02G327550	`PF24548`	EF_EFCAB10_C	190	207	0.092	13.1
TkA02G327550	`PF13833`	EF-hand_8	191	211	1.3e-14	54.4
TkA02G327550	`PF14658`	EF-hand_9	191	246	0.084	14.0
TkA02G327550	`PF12763`	EH	193	213	6.7e-05	23.5
TkA02G327550	`PF29176`	Allatotropin-like_C	194	206	0.0014	18.9
TkA02G327550	`PF00404`	Dockerin_1	194	243	0.0027	18.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SZ45`	Arabidopsis thaliana	sp\|Q9SZ45\|MICU_ARATH Calcium uptake protein, mitochondrial	58.900%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card