LXL04_015476 | RubberDandelionOmics

Gene overview

LXL04_015476

Reference: OH-1004 Chr: Chr03 Coordinates: 73215329-73217377 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1353 bp · LXL04_015476|LXL04_015476|OH1004|cDNA

ATGTCTTCTCTCAGGCGATCGACTCCCTCCATCCACCGCCAAATCCGCTCAATATCATCTACATCGCCTTCATTGATCGCTACATCAATCACCACCGCCTCCCCCGATTCTGATAACAGAAACCCTAGTTTACTGCGATGGCTTTCCGCCGTCGTCGCAGGCACCGGTGTGGGGATGTCTCTTTACTGGTGTTCACATTCCTTATCGTCTACATACGCGGAGAAAACAGCTACGGGTTTTGCTGATTGGATGACCGCAAC...

CDS

Download CDS FASTA

1353 bp · LXL04_015476|LXL04_015476|OH1004|CDS

ATGTCTTCTCTCAGGCGATCGACTCCCTCCATCCACCGCCAAATCCGCTCAATATCATCTACATCGCCTTCATTGATCGCTACATCAATCACCACCGCCTCCCCCGATTCTGATAACAGAAACCCTAGTTTACTGCGATGGCTTTCCGCCGTCGTCGCAGGCACCGGTGTGGGGATGTCTCTTTACTGGTGTTCACATTCCTTATCGTCTACATACGCGGAGAAAACAGCTACGGGTTTTGCTGATTGGATGACCGCAAC...

Protein

Download Protein FASTA

450 aa · LXL04_015476|LXL04_015476|OH1004|PROTEIN

MSSLRRSTPSIHRQIRSISSTSPSLIATSITTASPDSDNRNPSLLRWLSAVVAGTGVGMSLYWCSHSLSSTYAEKTATGFADWMTATADRIKELYESQPLSSSNFFIRDALRRRIFFNYEKRLRTLSPPAKVFEYFASVRNSKGESLMTPGDLMRAIVPVFPPSESNLVREGSLRGERRPGELHCDPSEFFMLFDVNNDGLISFKEYIFFVTLLSIPESSFSVAFKMFDIDNDGEIDREEFKKVMALMRGHNRQGHYFHK...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_015476`
TK1151 ID	TkA02G327550
OH-1004 ID	LXL04_015476
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.300
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_015476

Location Chr03:73215329-73217377 (+)

Description Similar to MICU: Calcium uptake protein, mitochondrial

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g32060`	Calcium-binding protein maintaining matrix calcium levels at low concentration.	The EF-Hand Ca2+ Binding Protein MICU Choreographs Mitochondrial Ca2+ Dynamics in Arabidopsis.2015 · DOI: 10.1105/tpc.15.00509

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_015476 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006816 calcium ion transport Biological Process

GO:0006851 mitochondrial calcium ion transmembrane transport Biological Process

GO:0036444 calcium import into the mitochondrion Biological Process

GO:0051260 protein homooligomerization Biological Process

GO:0051560 mitochondrial calcium ion homeostasis Biological Process

GO:0051561 positive regulation of mitochondrial calcium ion concentration Biological Process

GO:0051562 negative regulation of mitochondrial calcium ion concentration Biological Process

GO:0070509 calcium ion import Biological Process

GO:0071277 cellular response to calcium ion Biological Process

GO:0072732 cellular response to calcium ion starvation Biological Process

GO:1900069 regulation of cellular hyperosmotic salinity response Biological Process

GO:1903852 positive regulation of cristae formation Biological Process

KEGG gene cross-reference

ath:AT4G32060

bta:507899

mmu:216001

rno:365567

xtr:100127574

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Mitochondrion0.862

Rank 1 · LXL04_015476 · OH-1004

Cytoplasm0.072

Rank 2 · LXL04_015476 · OH-1004

Plastid0.056

Rank 3 · LXL04_015476 · OH-1004

Nucleus0.056

Rank 4 · LXL04_015476 · OH-1004

Cell membrane0.034

Rank 5 · LXL04_015476 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00036.39EF-hand_1189-212 aa

PF13499.13EF-hand_7190-245 aa

PF13833.13EF-hand_8216-245 aa

PF13405.13EF-hand_6223-246 aa

PF00036.39EF-hand_1224-247 aa

PF13202.13EF-hand_5224-245 aa

PF13499.13EF-hand_7381-427 aa

PF13833.13EF-hand_8384-432 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_015476	`PF00036.39`	EF-hand_1	189	212	6.6e-22	76.1
LXL04_015476	`PF13499.13`	EF-hand_7	190	245	1.2e-16	61.5
LXL04_015476	`PF13833.13`	EF-hand_8	216	245	5.2e-14	52.5
LXL04_015476	`PF13405.13`	EF-hand_6	223	246	1.1e-19	68.8
LXL04_015476	`PF00036.39`	EF-hand_1	224	247	6.6e-22	76.1
LXL04_015476	`PF13202.13`	EF-hand_5	224	245	3.6e-17	61.7
LXL04_015476	`PF13499.13`	EF-hand_7	381	427	1.2e-16	61.5
LXL04_015476	`PF13833.13`	EF-hand_8	384	432	5.2e-14	52.5
LXL04_015476	`PF00036.39`	EF-hand_1	407	431	6.6e-22	76.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SZ45`	Arabidopsis thaliana	Calcium uptake protein, mitochondrial	58.726%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card