TkA02G324270 | RubberDandelionOmics

Gene overview

TkA02G324270

Reference: TK1151 Chr: Chr02 Coordinates: 82289658-82291547 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

988 bp · TkA02G324270|TK1151|cDNA

TCTCTCTCTCTCTCTCTCTCTCTCTCACACATACATAAAATGGAACTTGAGCTCAGTCTCTCACCTCCCAATCAAAGCAGACATCCAATTATGAGGAAAAGCTGCCATGGGGGCGGTAACTCTGTGACAAGATGTCCTCTGGTTTCATGGGATCAAGAGGAAGAAGGTGAACCCAACAAAAGTTTCTATAATGGCGATTACCAACAGGATTTGGAAGGTGATGGAGAAGGGCTAGTTGGATGGCCACCATTGCATTCATG...

CDS

Download CDS FASTA

582 bp · TkA02G324270|TK1151|CDS

ATGGAACTTGAGCTCAGTCTCTCACCTCCCAATCAAAGCAGACATCCAATTATGAGGAAAAGCTGCCATGGGGGCGGTAACTCTGTGACAAGATGTCCTCTGGTTTCATGGGATCAAGAGGAAGAAGGTGAACCCAACAAAAGTTTCTATAATGGCGATTACCAACAGGATTTGGAAGGTGATGGAGAAGGGCTAGTTGGATGGCCACCATTGCATTCATGGAGGAGAAGGTTGATTGAAGGTGTAGGGTACAATATAAG...

Protein

Download Protein FASTA

193 aa · TkA02G324270|TK1151|PROTEIN

MELELSLSPPNQSRHPIMRKSCHGGGNSVTRCPLVSWDQEEEGEPNKSFYNGDYQQDLEGDGEGLVGWPPLHSWRRRLIEGVGYNIRDDEQEEEEEEGDNINVMNNNYNESLFVKVKMDGVGIARKIDLNAFHSYQMLKTTLLHMFDKYVEIDNDGASYKLVYQNKDGNWNLAGDLPWEIFVGAVHRIRMARN

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G324270`
TK1151 ID	TkA02G324270
OH-1004 ID	LXL04_015508
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	98.000
Protein coverage (%)	TK1151 76.684 / OH-1004 60.744 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G324270

Location Chr02:82289658-82291547 (-)

Description Similar to IAA11: Auxin-responsive protein IAA11

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g32280`	Aux/IAA proteins are short-lived transcriptional factors that function as repressors of early auxin response genes at low auxin concentrations.	No verified direct reference in this release
`At3g17600`	Aux/IAA proteins are short-lived transcriptional factors that function as repressors of early auxin response genes at low auxin concentrations.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`UniProt: A2XLV9`	Aux/IAA proteins are short-lived transcriptional factors that function as repressors of early auxin response genes at low auxin concentrations.	No verified direct reference in this release
`Os03g0742900`	Aux/IAA proteins are short-lived transcriptional factors that function as repressors of early auxin response genes at low auxin concentrations.	No verified direct reference in this release
`UniProt: A2XB18`	Aux/IAA proteins are short-lived transcriptional factors that function as repressors of early auxin response genes at low auxin concentrations.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_015508 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0009733 response to auxin Biological Process

GO:0009734 auxin-activated signaling pathway Biological Process

GO:0005634 nucleus Cellular Component

GO:0009506 plasmodesma Cellular Component

GO:0003700 DNA-binding transcription factor activity Molecular Function

GO:0042802 identical protein binding Molecular Function

KEGG gene cross-reference

ath:AT3G16500

ath:AT4G28640

dosa:Os02g0228900

dosa:Os03g0742900

dosa:Os05g0523300

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.866

Rank 1 · TkA02G324270 · TK1151

Cytoplasm0.193

Rank 2 · TkA02G324270 · TK1151

Cell membrane0.058

Rank 3 · TkA02G324270 · TK1151

Endoplasmic reticulum0.041

Rank 4 · TkA02G324270 · TK1151

Plastid0.017

Rank 5 · TkA02G324270 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02309AUX_IAA56-192 aa

PF22762NrS1-pol-like_tail81-150 aa

PF03776MinE133-162 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G324270	`PF02309`	AUX_IAA	56	192	6e-32	111.9
TkA02G324270	`PF22762`	NrS1-pol-like_tail	81	150	0.22	12.4
TkA02G324270	`PF03776`	MinE	133	162	0.047	14.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q93WC4`	Arabidopsis thaliana	sp\|Q93WC4\|IAA29_ARATH Auxin-responsive protein IAA29	47.000%	Swiss-Prot	Low
`Q8H174`	Arabidopsis thaliana	sp\|Q8H174\|IAA31_ARATH Auxin-responsive protein IAA31	36.500%	Swiss-Prot	Medium
`A2XLV9`	Oryza sativa subsp. indica	sp\|A2XLV9\|IAA13_ORYSI Auxin-responsive protein IAA13	39.100%	Swiss-Prot	Medium
`Q10D34`	Oryza sativa subsp. japonica	sp\|Q10D34\|IAA13_ORYSJ Auxin-responsive protein IAA13	39.100%	Swiss-Prot	Medium
`A2XB18`	Oryza sativa subsp. indica	sp\|A2XB18\|IAA10_ORYSI Auxin-responsive protein IAA10	32.700%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card