TkA02G318720 | RubberDandelionOmics

Gene overview

TkA02G318720

Reference: TK1151 Chr: Chr02 Coordinates: 80960791-80962077 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1287 bp · TkA02G318720|TK1151|cDNA

ATGACAGAGTCGGATGTAATGTTCGACGGTTCTTCACTTACAAAACAAAGAAATGTGGAATCAGTTTCATCATCGGGGTTCGATAAGCTCACCGACGAGCTAGTAATAGAAACCCTAATACGTCTCCCAATAAAGCCAGCCAATTTCTGTAAGTGCGTTTCAAGACGGTTTCATTCTTTGATTTCAAGTTCGTATTTCGTTCGCTGTTATGTGAATCATCATCAAATCAGCAATTCATTTGCTCTTTATTACCAATCGAA...

CDS

Download CDS FASTA

1287 bp · TkA02G318720|TK1151|CDS

ATGACAGAGTCGGATGTAATGTTCGACGGTTCTTCACTTACAAAACAAAGAAATGTGGAATCAGTTTCATCATCGGGGTTCGATAAGCTCACCGACGAGCTAGTAATAGAAACCCTAATACGTCTCCCAATAAAGCCAGCCAATTTCTGTAAGTGCGTTTCAAGACGGTTTCATTCTTTGATTTCAAGTTCGTATTTCGTTCGCTGTTATGTGAATCATCATCAAATCAGCAATTCATTTGCTCTTTATTACCAATCGAA...

Protein

Download Protein FASTA

428 aa · TkA02G318720|TK1151|PROTEIN

MTESDVMFDGSSLTKQRNVESVSSSGFDKLTDELVIETLIRLPIKPANFCKCVSRRFHSLISSSYFVRCYVNHHQISNSFALYYQSKPTFHNLIRPSLMGIDIAFEFPIFESPGFSLSFLACSDQQKQETLQYLASNNGLVLCCAALRRPIVYFVCNPLTKQWIALPPPPSNVKTVYIGFICNPQYSCNTDHEQGRKTRFKVVRIEVVNCDSPRQPSGTLKLEIFCSVSGIWTEYFMSSSTSDHELFNGWNYRCPSAVVC...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G318720`
TK1151 ID	TkA02G318720
OH-1004 ID	LXL04_015538
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	99.800
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA02G318720`
Location	Chr02:80960791-80962077 (-)
Description	Similar to At3g26010: F-box protein At3g26010
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_015538` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0016567 protein ubiquitination Biological Process GO:0031146 SCF-dependent proteasomal ubiquitin-dependent protein catabolic process Biological Process GO:0005634 nucleus Cellular Component GO:0005739 mitochondrion Cellular Component GO:0004842 ubiquitin-protein transferase activity Molecular Function
KEGG gene cross-reference	ath:AT3G23950 ath:AT3G23970 ath:AT3G26010 ath:AT4G22430 ath:AT5G49610 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.492

Rank 1 · TkA02G318720 · TK1151

Nucleus0.486

Rank 2 · TkA02G318720 · TK1151

Cell membrane0.152

Rank 3 · TkA02G318720 · TK1151

Endoplasmic reticulum0.071

Rank 4 · TkA02G318720 · TK1151

Lysosome / Vacuole0.028

Rank 5 · TkA02G318720 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00646F-box28-66 aa

PF06542PHA-138-64 aa

PF24750b-prop_At3g26010-like118-390 aa

PF07734FBA_1122-268 aa

PF08268FBA_3126-180 aa

PF06542PHA-1172-208 aa

PF08268FBA_3273-387 aa

PF24750b-prop_At3g26010-like408-422 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G318720	`PF00646`	F-box	28	66	0.00015	22.3
TkA02G318720	`PF06542`	PHA-1	38	64	0.23	11.0
TkA02G318720	`PF24750`	b-prop_At3g26010-like	118	390	2.2e-30	106.6
TkA02G318720	`PF07734`	FBA_1	122	268	0.00014	21.8
TkA02G318720	`PF08268`	FBA_3	126	180	0.0006	19.7
TkA02G318720	`PF06542`	PHA-1	172	208	0.23	11.0
TkA02G318720	`PF08268`	FBA_3	273	387	0.0006	19.7
TkA02G318720	`PF24750`	b-prop_At3g26010-like	408	422	2.2e-30	106.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card