LXL04_015538 | RubberDandelionOmics

Gene overview

LXL04_015538

Reference: OH-1004 Chr: Chr03 Coordinates: 75243815-75245101 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1287 bp · LXL04_015538|LXL04_015538|OH1004|cDNA

ATGACAGAGTCGGATGTAATGTTCGACGGTTCTTCACTTACAAAACAAAGAAATGTGGAATCAGTTTCATCATCGGGGTTCGATAAGCTCACCGACGAGCTAGTAATAGAAACCCTAATACGTCTCCCAATAAAGCCAGCCAATTTCTGTAAGTGCGTTTCAAGACGGTTTCATTCTTTGATTTCAAGTTCGTATTTCGTTCGCTGTTATGTGAATCATCATCAAATCAACAATTCATTTGCTCTTTATTACCAATCGAA...

CDS

Download CDS FASTA

1287 bp · LXL04_015538|LXL04_015538|OH1004|CDS

ATGACAGAGTCGGATGTAATGTTCGACGGTTCTTCACTTACAAAACAAAGAAATGTGGAATCAGTTTCATCATCGGGGTTCGATAAGCTCACCGACGAGCTAGTAATAGAAACCCTAATACGTCTCCCAATAAAGCCAGCCAATTTCTGTAAGTGCGTTTCAAGACGGTTTCATTCTTTGATTTCAAGTTCGTATTTCGTTCGCTGTTATGTGAATCATCATCAAATCAACAATTCATTTGCTCTTTATTACCAATCGAA...

Protein

Download Protein FASTA

428 aa · LXL04_015538|LXL04_015538|OH1004|PROTEIN

MTESDVMFDGSSLTKQRNVESVSSSGFDKLTDELVIETLIRLPIKPANFCKCVSRRFHSLISSSYFVRCYVNHHQINNSFALYYQSKPTFHNLIRPSLMGIDIAFEFPIFESPGFSLSFLACSDQQKQETLQYLASNNGLVLCCAALRRPIVYFVCNPLTKQWIALPPPPSNVKTVYIGFICNPQYSCNTDHEQGRKTRFKVVRIEVVNCDSPRQPSGTLKLEIFCSVSGIWTEYFMSSSTSDHELFNGWNYRCPSAVVC...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_015538`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_015538

Location Chr03:75243815-75245101 (+)

Description Similar to At3g26010: F-box protein At3g26010

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g26010`	F-box protein At3g26010.	No verified direct reference in this release
`At3g23970`	Putative F-box protein At3g23970.	No verified direct reference in this release
`At3g23950`	Putative F-box protein At3g23950.	No verified direct reference in this release
`At4g22430`	Putative F-box/kelch-repeat protein At4g22430.	No verified direct reference in this release
`At5g49610`	F-box protein At5g49610.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_015538 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0016567 protein ubiquitination Biological Process

GO:0031146 SCF-dependent proteasomal ubiquitin-dependent protein catabolic process Biological Process

GO:0005634 nucleus Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0004842 ubiquitin-protein transferase activity Molecular Function

KEGG gene cross-reference

ath:AT3G23950

ath:AT3G23970

ath:AT3G26010

ath:AT4G22430

ath:AT5G49610

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.495

Rank 1 · LXL04_015538 · OH-1004

Nucleus0.479

Rank 2 · LXL04_015538 · OH-1004

Cell membrane0.155

Rank 3 · LXL04_015538 · OH-1004

Endoplasmic reticulum0.071

Rank 4 · LXL04_015538 · OH-1004

Lysosome / Vacuole0.028

Rank 5 · LXL04_015538 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF24750.2b-prop_At3g26010-like118-390 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_015538	`PF24750.2`	b-prop_At3g26010-like	118	390	2.2e-30	106.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LU90`	Arabidopsis thaliana	F-box protein At3g26010	24.703%	Swiss-Prot	weak database homology
`Q9LIR0`	Arabidopsis thaliana	Putative F-box protein At3g23970	26.260%	Swiss-Prot	weak database homology
`Q9LIR3`	Arabidopsis thaliana	Putative F-box protein At3g23950	25.065%	Swiss-Prot	weak database homology
`Q1PE57`	Arabidopsis thaliana	Putative F-box/kelch-repeat protein At4g22430	21.833%	Swiss-Prot	weak database homology
`Q9FGY4`	Arabidopsis thaliana	F-box protein At5g49610	23.262%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card