Gene Card
Gene overview
cDNA / CDS / Protein Sequences
1688 bp · TkA02G312220|TK1151|cDNA
GTGAGAAGTAGAACACGTGTTATAAAGAAAAAAACACGTGTGCTATCGATACGTCATCGTTCCTATATTGCAACGGCACTTCCAATTCCGTGTCGTAGTCGGAGTCTCCACCACAGACATCGGTGTTTGTTCTCTACTGAGATCCTCCGCCACAATACTGCTAAAACCCTAGAATCCGAGCCCCTAGATCCCAATCGTGCTAATCGAATCTATTAAGCTCGACTTTTGTAATACATTAGCAGAAACAGCATTAAAGGAAC...
1134 bp · TkA02G312220|TK1151|CDS
ATGAAAATGGAAGGAATTAAAAAAGTTGTGATTTTAGATAGCGGAGATAATGGGAGCTCCTCGTCACCAACCGACGGTAAACCTCCCAATCCACTCACCACCACCCCAGGCTATCGCCGGTGCTTCAGTGCCTCAGGTGACGTCGTGGATTCTTCATCTATTAAGAAGTCTTTCGTTCGTCACCCATCTCTGTTAAGGACAAGGCTGGAAGATGCATCTGTTGAAATACTGAATGAAGACAAATGTAAAGGCGAGTTTCT...
Protein
Download Protein FASTA377 aa · TkA02G312220|TK1151|PROTEIN
MKMEGIKKVVILDSGDNGSSSSPTDGKPPNPLTTTPGYRRCFSASGDVVDSSSIKKSFVRHPSLLRTRLEDASVEILNEDKCKGEFLPVVRSGAWADMGFRGSMEDVYICADSFVHDYGGKNPIEGPAAFYAVFDGHGGKHAADFACHHLPRFIFEDTDFPMEMERVITSAFTQTDTAFAQACTLDADLASGTTALAALVIGSSLVVANAGDCRAVLCRRGKAVEMSRDHKPICVKERKRIEASGGYVYDGYLNGQLNVA...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA02G312220 |
|---|---|
| TK1151 ID | TkA02G312220 |
| OH-1004 ID | LXL04_015584 |
| Relationship / confidence | Rbh High Identity Coverage Synteny / Strict |
| Protein identity (%) | 99.500 |
| Protein coverage (%) | TK1151 100.000 / OH-1004 96.667Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA02G312220 | |||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr02:79439566-79442924 (+) | |||||||||||||||||||||
| Description | Similar to At2g25620: Probable protein phosphatase 2C 22 | |||||||||||||||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
Rice
| |||||||||||||||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | |||||||||||||||||||||
| GO annotations (OH1004 source) | GO:0007165 signal transduction Biological Process GO:0009414 response to water deprivation Biological Process GO:0009651 response to salt stress Biological Process GO:0009737 response to abscisic acid Biological Process GO:0050688 regulation of defense response to virus Biological Process GO:0005634 nucleus Cellular Component GO:0005737 cytoplasm Cellular Component GO:0005829 cytosol Cellular Component GO:0009507 chloroplast Cellular Component GO:0004722 protein serine/threonine phosphatase activity Molecular Function GO:0046872 metal ion binding Molecular Function | |||||||||||||||||||||
| KEGG gene cross-reference | ath:AT2G25620 ath:AT2G33700 dosa:Os02g0799000 dosa:Os06g0179700 dosa:Os06g0597200 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF00481PP2C99-346 aaPF13672PP2C_2131-224 aaPF13672PP2C_2283-323 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| TkA02G312220 | PF00481 | PP2C | 99 | 346 | 6.7e-68 | 229.8 |
| TkA02G312220 | PF13672 | PP2C_2 | 131 | 224 | 0.059 | 13.7 |
| TkA02G312220 | PF13672 | PP2C_2 | 283 | 323 | 0.059 | 13.7 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.
| Protein | Organism | Description | Identity | Database | Confidence |
|---|---|---|---|---|---|
Q9SLA1 | Arabidopsis thaliana | sp|Q9SLA1|P2C22_ARATH Probable protein phosphatase 2C 22 | 65.100% | Swiss-Prot | High |
P93006 | Arabidopsis thaliana | sp|P93006|P2C27_ARATH Probable protein phosphatase 2C 27 | 52.400% | Swiss-Prot | High |
Q69VD9 | Oryza sativa subsp. japonica | sp|Q69VD9|P2C57_ORYSJ Probable protein phosphatase 2C 57 | 65.400% | Swiss-Prot | High |
Q69QZ0 | Oryza sativa subsp. japonica | sp|Q69QZ0|P2C27_ORYSJ Probable protein phosphatase 2C 27 | 58.000% | Swiss-Prot | High |
Q5SMK6 | Oryza sativa subsp. japonica | sp|Q5SMK6|P2C54_ORYSJ Probable protein phosphatase 2C 54 | 50.100% | Swiss-Prot | High |