LXL04_015584 | RubberDandelionOmics

Gene overview

LXL04_015584

Reference: OH-1004 Chr: Chr03 Coordinates: 76832312-76835150 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1173 bp · LXL04_015584|LXL04_015584|OH1004|cDNA

ATGAAAATGGAAGGAATTAAAAAAGTTGTGATTTTAGATAGCGGAGATAATGGGAGCTCCTCGTCACCAACCGACGGTAAACCTCCCAATCCACTCACCACCACCCCAGGCTATCGCCGGTGCTTCAGTGCCTCAGGTGACGTCGTGGATTCTTCATCTATTAAGAAGTCTTTCGTTCGTCACCCATCTCTGTTAAGGACAAGGCTGGAAGATGCATCTGTTGAAATACTGAATGAAGACAATTGTAAAGGCGAGTTTCT...

CDS

Download CDS FASTA

1173 bp · LXL04_015584|LXL04_015584|OH1004|CDS

ATGAAAATGGAAGGAATTAAAAAAGTTGTGATTTTAGATAGCGGAGATAATGGGAGCTCCTCGTCACCAACCGACGGTAAACCTCCCAATCCACTCACCACCACCCCAGGCTATCGCCGGTGCTTCAGTGCCTCAGGTGACGTCGTGGATTCTTCATCTATTAAGAAGTCTTTCGTTCGTCACCCATCTCTGTTAAGGACAAGGCTGGAAGATGCATCTGTTGAAATACTGAATGAAGACAATTGTAAAGGCGAGTTTCT...

Protein

Download Protein FASTA

390 aa · LXL04_015584|LXL04_015584|OH1004|PROTEIN

MKMEGIKKVVILDSGDNGSSSSPTDGKPPNPLTTTPGYRRCFSASGDVVDSSSIKKSFVRHPSLLRTRLEDASVEILNEDNCKGEFLPVVRSGAWADMGFRGSMEDVYICADSFVHDYGGKNPIEGPAAFYAVFDGHGGKHAADFACHHLPRFIFEDTDFPMEMERVITSAFTQTDTAFAQACTLDADLASGTTALAALVIGSSLVVANAGDCRAVLCRRGKAVEMSRDHKPICVKERKRIEASGGYVYDGYLNGQLNVA...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_015584`
TK1151 ID	TkA02G312220
OH-1004 ID	LXL04_015584
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.500
Protein coverage (%)	TK1151 100.000 / OH-1004 96.667 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_015584

Location Chr03:76832312-76835150 (-)

Description Similar to At2g25620: Probable protein phosphatase 2C 22

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g25620`	Probable protein phosphatase 2C 22.	No verified direct reference in this release
`At2g33700`	Confers salt tolerance by triggering the expression of stress-responsive genes.	AtPP2CG1, a protein phosphatase 2C, positively regulates salt tolerance of Arabidopsis in abscisic acid-dependent manner.2012 · DOI: 10.1016/j.bbrc.2012.05.064

Rice

Reference gene ID	Possible function	Papers / DOI
`Os06g0597200`	Probable protein phosphatase 2C 57.	No verified direct reference in this release
`Os02g0799000`	Probable protein phosphatase 2C 27.	No verified direct reference in this release
`Os06g0179700`	Probable protein phosphatase 2C 54.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_015584 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0007165 signal transduction Biological Process

GO:0009414 response to water deprivation Biological Process

GO:0009651 response to salt stress Biological Process

GO:0009737 response to abscisic acid Biological Process

GO:0050688 regulation of defense response to virus Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005829 cytosol Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0004722 protein serine/threonine phosphatase activity Molecular Function

GO:0046872 metal ion binding Molecular Function

KEGG gene cross-reference

ath:AT2G25620

ath:AT2G33700

dosa:Os02g0799000

dosa:Os06g0179700

dosa:Os06g0597200

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.487

Rank 1 · LXL04_015584 · OH-1004

Cytoplasm0.436

Rank 2 · LXL04_015584 · OH-1004

Cell membrane0.165

Rank 3 · LXL04_015584 · OH-1004

Endoplasmic reticulum0.055

Rank 4 · LXL04_015584 · OH-1004

Golgi apparatus0.044

Rank 5 · LXL04_015584 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00481.27PP2C99-346 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_015584	`PF00481.27`	PP2C	99	346	7.4e-68	229.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SLA1`	Arabidopsis thaliana	Probable protein phosphatase 2C 22	65.544%	Swiss-Prot	strong database homology
`P93006`	Arabidopsis thaliana	Probable protein phosphatase 2C 27	50.137%	Swiss-Prot	strong database homology
`Q69VD9`	Oryza sativa subsp. japonica	Probable protein phosphatase 2C 57	66.185%	Swiss-Prot	strong database homology
`Q69QZ0`	Oryza sativa subsp. japonica	Probable protein phosphatase 2C 27	57.705%	Swiss-Prot	strong database homology
`Q5SMK6`	Oryza sativa subsp. japonica	Probable protein phosphatase 2C 54	53.548%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card