TkA02G312080 | RubberDandelionOmics

Gene overview

TkA02G312080

Reference: TK1151 Chr: Chr02 Coordinates: 79401814-79411964 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

345 bp · TkA02G312080|TK1151|cDNA

ATGTATGGATTTTATGATGAATGCCTTCGGAAGTATGGAAATGCTAATGTTTTGAAAACATTCACCGATCTTTTCGATTATTTCCCACTGACTGCATTGATCCCAGAACTGTATGGCCAGTCAAATTCTCCTCAGTTGGAATGCATTGCATCCCTTGATTCACACAGTTCAAAGATTAAGTGTGTGCTATGGTGGCCATCTGGAAGACATGACAAGTTGATCAGTATTGATGAACAGAATATCTTTCTTTGGAGCTTAGA...

CDS

Download CDS FASTA

345 bp · TkA02G312080|TK1151|CDS

ATGTATGGATTTTATGATGAATGCCTTCGGAAGTATGGAAATGCTAATGTTTTGAAAACATTCACCGATCTTTTCGATTATTTCCCACTGACTGCATTGATCCCAGAACTGTATGGCCAGTCAAATTCTCCTCAGTTGGAATGCATTGCATCCCTTGATTCACACAGTTCAAAGATTAAGTGTGTGCTATGGTGGCCATCTGGAAGACATGACAAGTTGATCAGTATTGATGAACAGAATATCTTTCTTTGGAGCTTAGA...

Protein

Download Protein FASTA

114 aa · TkA02G312080|TK1151|PROTEIN

MYGFYDECLRKYGNANVLKTFTDLFDYFPLTALIPELYGQSNSPQLECIASLDSHSSKIKCVLWWPSGRHDKLISIDEQNIFLWSLDSSTSESSIQFWDLRIMKYALIFGLAPF

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G312080`
TK1151 ID	TkA02G312080
OH-1004 ID	LXL04_015184
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	66.300
Protein coverage (%)	TK1151 62.281 / OH-1004 30.058 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G312080

Location Chr02:79401814-79411964 (+)

Description Similar to DWA2: WD repeat-containing protein DWA2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g76260`	Component of the CUL4-RBX1-DDB1-DWA1/DWA2 E3 ubiquitin- protein ligase complex that acts as a negative regulator in abscisic acid (ABA) signaling.	DWA1 and DWA2, two Arabidopsis DWD protein components of CUL4-based E3 ligases, act together as negative regulators in ABA signal transduction.2010 · DOI: 10.1105/tpc.109.073783

Rice

Reference gene ID	Possible function	Papers / DOI
`UniProt: A2XN40`	Serine/threonine-protein phosphatase PP2A-2 catalytic subunit.	No verified direct reference in this release
`Os03g0805300`	Serine/threonine-protein phosphatase PP2A-2 catalytic subunit.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_015184 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009738 abscisic acid-activated signaling pathway Biological Process

GO:0009788 negative regulation of abscisic acid-activated signaling pathway Biological Process

GO:0016567 protein ubiquitination Biological Process

GO:0032456 endocytic recycling Biological Process

GO:0051049 regulation of transport Biological Process

GO:1905281 positive regulation of retrograde transport, endosome to Golgi Biological Process

GO:2001137 positive regulation of endocytic recycling Biological Process

GO:0000938 GARP complex Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005654 nucleoplasm Cellular Component

GO:0005730 nucleolus Cellular Component

GO:0005794 Golgi apparatus Cellular Component

KEGG gene cross-reference

ath:AT1G76260

gja:107122311

rno:362721

xtr:496745

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.544

Rank 1 · TkA02G312080 · TK1151

Cytoplasm0.440

Rank 2 · TkA02G312080 · TK1151

Lysosome / Vacuole0.051

Rank 3 · TkA02G312080 · TK1151

Mitochondrion0.050

Rank 4 · TkA02G312080 · TK1151

Golgi apparatus0.048

Rank 5 · TkA02G312080 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00149Metallophos4-76 aa

PF23609Beta-prop_EIPR139-91 aa

PF24797Beta-prop_WDR35_TULP_N39-87 aa

PF24105Beta-prop_CAF1B_HIR140-92 aa

PF23381Beta-prop_IFT122_1st45-91 aa

PF24814WD40_Prp1946-86 aa

PF00400WD4047-84 aa

PF25174Beta-prop_THOC348-96 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G312080	`PF00149`	Metallophos	4	76	0.0074	17.5
TkA02G312080	`PF23609`	Beta-prop_EIPR1	39	91	4.8e-13	49.9
TkA02G312080	`PF24797`	Beta-prop_WDR35_TULP_N	39	87	0.029	14.3
TkA02G312080	`PF24105`	Beta-prop_CAF1B_HIR1	40	92	0.0081	15.9
TkA02G312080	`PF23381`	Beta-prop_IFT122_1st	45	91	0.014	15.4
TkA02G312080	`PF24814`	WD40_Prp19	46	86	0.1	12.4
TkA02G312080	`PF00400`	WD40	47	84	0.076	14.3
TkA02G312080	`PF25174`	Beta-prop_THOC3	48	96	0.15	11.8
TkA02G312080	`PF24814`	WD40_Prp19	87	104	0.1	12.4
TkA02G312080	`PF23609`	Beta-prop_EIPR1	91	104	4.8e-13	49.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q6NPN9`	Arabidopsis thaliana	sp\|Q6NPN9\|DWA2_ARATH WD repeat-containing protein DWA2	52.900%	Swiss-Prot	Medium
`A2XN40`	Oryza sativa subsp. indica	sp\|A2XN40\|PP2A2_ORYSI Serine/threonine-protein phosphatase PP2A-2 catalytic subunit	64.300%	Swiss-Prot	Low
`Q10BT5`	Oryza sativa subsp. japonica	sp\|Q10BT5\|PP2A2_ORYSJ Serine/threonine-protein phosphatase PP2A-2 catalytic subunit	64.300%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card