TkA02G308520 | RubberDandelionOmics

Gene overview

TkA02G308520

Reference: TK1151 Chr: Chr02 Coordinates: 78508257-78509114 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

639 bp · TkA02G308520|TK1151|cDNA

ATGCTTTGTGCAAGTATGTGTCACACTGATATTCTTTGTTGCAATGGCCTCCCTGTCCCTTTGTTCCCTCGGATTCCTGGACATGAAGGAGTAGGTGAGATCGAGAGCATGGGAGAGAAGGTGACGAAGCTTAAGGTGGGAGATATAGTGATGCCACTCTATCTTGGAGAGTGTGGAGAGTGTCTAAACTGCAGTTCAGGGAGGACTAATCTATGCCACAAGTATCCACTTGGTTTCACTGGTCTTCTCTCTGATGCCAC...

CDS

Download CDS FASTA

639 bp · TkA02G308520|TK1151|CDS

ATGCTTTGTGCAAGTATGTGTCACACTGATATTCTTTGTTGCAATGGCCTCCCTGTCCCTTTGTTCCCTCGGATTCCTGGACATGAAGGAGTAGGTGAGATCGAGAGCATGGGAGAGAAGGTGACGAAGCTTAAGGTGGGAGATATAGTGATGCCACTCTATCTTGGAGAGTGTGGAGAGTGTCTAAACTGCAGTTCAGGGAGGACTAATCTATGCCACAAGTATCCACTTGGTTTCACTGGTCTTCTCTCTGATGCCAC...

Protein

Download Protein FASTA

212 aa · TkA02G308520|TK1151|PROTEIN

MLCASMCHTDILCCNGLPVPLFPRIPGHEGVGEIESMGEKVTKLKVGDIVMPLYLGECGECLNCSSGRTNLCHKYPLGFTGLLSDATSRMSIGGQQIYHHFSCSTWSEYIVLDANYAVKVDPRLSLPHASFLCCGFTTGFGSTWRAVTIEKGSTVAVIGLGAVGLGAVKGAQMQGASKIIGIDINEMKHDKAKALGSRSLSTLSFRMNPCPH

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G308520`
TK1151 ID	TkA02G308520
OH-1004 ID	LXL04_033455
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	70.500
Protein coverage (%)	TK1151 92.453 / OH-1004 47.847 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA02G308520`
Location	Chr02:78508257-78509114 (+)
Description	Similar to ADH1: Alcohol dehydrogenase 1
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_033455` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0008299 isoprenoid biosynthetic process Biological Process GO:0009753 response to jasmonic acid Biological Process GO:0009820 alkaloid metabolic process Biological Process GO:0035834 indole alkaloid metabolic process Biological Process GO:0046294 formaldehyde catabolic process Biological Process GO:0005634 nucleus Cellular Component GO:0005829 cytosol Cellular Component GO:0008270 zinc ion binding Molecular Function GO:0018457 perillyl-alcohol dehydrogenase (NAD+) activity Molecular Function GO:0051903 S-(hydroxymethyl)glutathione dehydrogenase [NAD(P)+] activity Molecular Function GO:0102311 8-hydroxygeraniol dehydrogenase activity Molecular Function
KEGG gene cross-reference	No functional description available

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.448

Rank 1 · TkA02G308520 · TK1151

Peroxisome0.235

Rank 2 · TkA02G308520 · TK1151

Nucleus0.151

Rank 3 · TkA02G308520 · TK1151

Mitochondrion0.126

Rank 4 · TkA02G308520 · TK1151

Plastid0.076

Rank 5 · TkA02G308520 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF08240ADH_N3-121 aa

PF01262AlaDh_PNT_C148-203 aa

PF028262-Hacid_dh_C151-199 aa

PF03721UDPG_MGDP_dh_N154-193 aa

PF02254TrkA_N155-196 aa

PF11431Transport_MerF155-170 aa

PF00107ADH_zinc_N162-196 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G308520	`PF08240`	ADH_N	3	121	5.4e-20	72.3
TkA02G308520	`PF01262`	AlaDh_PNT_C	148	203	0.0032	17.6
TkA02G308520	`PF02826`	2-Hacid_dh_C	151	199	0.02	15.0
TkA02G308520	`PF03721`	UDPG_MGDP_dh_N	154	193	0.04	14.3
TkA02G308520	`PF02254`	TrkA_N	155	196	0.081	14.0
TkA02G308520	`PF11431`	Transport_MerF	155	170	2.1	9.0
TkA02G308520	`PF00107`	ADH_zinc_N	162	196	2.4e-05	25.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card