TkA02G288080 | RubberDandelionOmics

Gene overview

TkA02G288080

Reference: TK1151 Chr: Chr02 Coordinates: 73630293-73635324 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2246 bp · TkA02G288080|TK1151|cDNA

GTACTTTGTAGGATGCTATGCTTCATAGAAACATGGGATTGCTCACATTGTATGCTTCCTTCCCCGTTCGTTGTCAGCGGCAACTAAACCCCTCCTGCAACCAGCTTCTTAAACCCTACTGTTTCAGTCAATCACAATCGGCCGCCATGAAAGCCCCCCTCGAAGAAACCGACGTAGGCATCTCTTGCTACATCTCCCCTCTCCCTGGTTTTCGTGGCATTCTCAAGCAAAGGTACTCTGATTTTACAGTCAATGAAGTA...

CDS

Download CDS FASTA

1242 bp · TkA02G288080|TK1151|CDS

ATGCTTCATAGAAACATGGGATTGCTCACATTGTATGCTTCCTTCCCCGTTCGTTGTCAGCGGCAACTAAACCCCTCCTGCAACCAGCTTCTTAAACCCTACTGTTTCAGTCAATCACAATCGGCCGCCATGAAAGCCCCCCTCGAAGAAACCGACGTAGGCATCTCTTGCTACATCTCCCCTCTCCCTGGTTTTCGTGGCATTCTCAAGCAAAGGTACTCTGATTTTACAGTCAATGAAGTAGATTTGGATGAAAATGT...

Protein

Download Protein FASTA

413 aa · TkA02G288080|TK1151|PROTEIN

MLHRNMGLLTLYASFPVRCQRQLNPSCNQLLKPYCFSQSQSAAMKAPLEETDVGISCYISPLPGFRGILKQRYSDFTVNEVDLDENVIHLTSLDAPMEAAEEHEPKTTDQPNGNHCTEIESFRALVGDSDANSLKEIIEKIKSNDEDGATSIVLSPSSDKVHRTAVHNFFKEKLKFLVTDTVDGPETSSKCIRVRLNSGGNNERGRGSNSKKRKGRDETPYDSRGSDHWPEHLGKFLRFHLCKENKDTQEALGVIGKMLG...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G288080`
TK1151 ID	TkA02G288080
OH-1004 ID	LXL04_015768
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	96.000
Protein coverage (%)	TK1151 91.283 / OH-1004 58.089 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA02G288080`
Location	Chr02:73630293-73635324 (-)
Description	Similar to PUS7: Multisubstrate pseudouridine synthase 7 (Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_015768` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0000455 enzyme-directed rRNA pseudouridine synthesis Biological Process GO:0001522 pseudouridine synthesis Biological Process GO:0006397 mRNA processing Biological Process GO:0006400 tRNA modification Biological Process GO:0008380 RNA splicing Biological Process GO:0017148 negative regulation of translation Biological Process GO:0031119 tRNA pseudouridine synthesis Biological Process GO:0031120 snRNA pseudouridine synthesis Biological Process GO:1990481 mRNA pseudouridine synthesis Biological Process GO:0005634 nucleus Cellular Component GO:0005654 nucleoplasm Cellular Component GO:0005737 cytoplasm Cellular Component
KEGG gene cross-reference	bta:615644 hsa:54517 mmu:78697 sce:YOR243C spo:2540668 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Mitochondrion0.858

Rank 1 · TkA02G288080 · TK1151

Nucleus0.152

Rank 2 · TkA02G288080 · TK1151

Cytoplasm0.111

Rank 3 · TkA02G288080 · TK1151

Plastid0.027

Rank 4 · TkA02G288080 · TK1151

Cell membrane0.021

Rank 5 · TkA02G288080 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01142TruD53-87 aa

PF23943PUS7L_N123-183 aa

PF25094R3H_PUS7L152-177 aa

PF01142TruD231-411 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G288080	`PF01142`	TruD	53	87	1.9e-51	176.0
TkA02G288080	`PF23943`	PUS7L_N	123	183	4.9e-06	27.3
TkA02G288080	`PF25094`	R3H_PUS7L	152	177	0.16	12.9
TkA02G288080	`PF01142`	TruD	231	411	1.9e-51	176.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card