TkA02G283350 | RubberDandelionOmics

Gene overview

TkA02G283350

Reference: TK1151 Chr: Chr02 Coordinates: 72322718-72326402 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1271 bp · TkA02G283350|TK1151|cDNA

GTGAATAGTGTCGGCTCTGCATCAGCTTCCGCCGTTCTCTGTTTTTGCCGTTCATTTTCTTCTGCCTCACCTTCGGCTCAGCTGCGCCGCGTCTGGGAGCTCAGCGTGCTCAGAATTTATCAAGGCTTTCGTCATTATTACGTCGCCCCTGAATTGCTTCCGGTACAGCTGCTTACTTCCACGCTCTTCTTCTTCCTTCTTATCCAATTTCAAGAGTTTACTGGATTTGTTTCGCCCTCGCCGCCTGTCTTTGCAACGTG...

CDS

Download CDS FASTA

633 bp · TkA02G283350|TK1151|CDS

ATGATGGTAAAACGCCACTTTCGTTATCTTTTGCAAGGATATGGAGATAATATTGATGTTGATCTAACTAACCAGCATGGTAACAAGAGCCTTTTAAACCTGGTATTTGCCACTGAAATGGAAAAACTTCAAGATGTTTGGTGCTTCTTTACTCTTTGTTCCAATGAAGATCCTTACTATGTACTGGCAACCGGTCCCCCTTTTCCATATTATGTACCTTACGGTGTACGAAACGATGGACCAAATGGTGCTGGTAAAAA...

Protein

Download Protein FASTA

210 aa · TkA02G283350|TK1151|PROTEIN

MMVKRHFRYLLQGYGDNIDVDLTNQHGNKSLLNLVFATEMEKLQDVWCFFTLCSNEDPYYVLATGPPFPYYVPYGVRNDGPNGAGKKFQNNKEDMSNSVTLGVAEEHIGIVVGRSVITVSDYVYIMIPAMTVHQLNVIHETIFLGTETAAELKAQGVTYRRVPIMSLALKGLASKYGRWNPSSLKSHARIMRLFQVFGIDVRNKNFTNCV

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G283350`
TK1151 ID	TkA02G283350
OH-1004 ID	LXL04_016023
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	94.300
Protein coverage (%)	TK1151 75.238 / OH-1004 76.119 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G283350

Location Chr02:72322718-72326402 (-)

Description Similar to BTR1: Protein BTR1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g04430`	Negative regulator of tomato mosaic virus (ToMV) multiplication, but has no effect on the multiplication of cucumber mosaic virus (CMV).	Identification of an Arabidopsis thaliana protein that binds to tomato mosaic virus genomic RNA and inhibits its multiplication.2008 · DOI: 10.1016/j.virol.2008.07.033

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_016023 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006396 RNA processing Biological Process

GO:0008380 RNA splicing Biological Process

GO:0046719 regulation by virus of viral protein levels in host cell Biological Process

GO:0046856 phosphatidylinositol dephosphorylation Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005783 endoplasmic reticulum Cellular Component

GO:0005789 endoplasmic reticulum membrane Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0003727 single-stranded RNA binding Molecular Function

GO:0003729 mRNA binding Molecular Function

KEGG gene cross-reference

ath:AT3G51830

ath:AT5G04430

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.385

Rank 1 · TkA02G283350 · TK1151

Nucleus0.371

Rank 2 · TkA02G283350 · TK1151

Mitochondrion0.159

Rank 3 · TkA02G283350 · TK1151

Cell membrane0.090

Rank 4 · TkA02G283350 · TK1151

Endoplasmic reticulum0.071

Rank 5 · TkA02G283350 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02383Syja_N3-45 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G283350	`PF02383`	Syja_N	3	45	0.0037	17.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LZ82`	Arabidopsis thaliana	sp\|Q9LZ82\|BTR1_ARATH Protein BTR1	48.300%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card