TkA02G282780 | RubberDandelionOmics

Gene overview

TkA02G282780

Reference: TK1151 Chr: Chr02 Coordinates: 72146548-72151715 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2891 bp · TkA02G282780|TK1151|cDNA

GGACTCTATATGGTAACTACCAGATTTAGCTTACGGCGCAATTAACAAGCAAACTTGTAATCACAGAGAGGGAGAGAGAGAGAGGAACCGTCGATGTGAAGGTCAAACACAACAAACACTTTGAAAATCTCTGACCGCTGTAATCTCCGCCGTGTTCTTGCAATATTTCTTTTCCGGCGAAGTTCATCATTTGATGCCCTATTCTATCGTGAATCTTATTCGACGCTCGGCGGTGAGTGGTGGAGGAGGAGGAGGGGGTG...

CDS

Download CDS FASTA

1215 bp · TkA02G282780|TK1151|CDS

ATGACTTCTGCTGTAATACAAGACATTTGTTTTAGTCCGTATAGTCAATGGATAGCAGTAGTTCATCAAGGGGGACGTGTCATATCTTTTTATATCCCCTTTGGTGGTGGTGAAACGGGAATCCAGTTACAAAACTCAAAAACAACTGGGAGCTTGCCTTTTGTATCACTACCATGGTGGTCCACTTGTTCTTTCTCAAAAGACCAACCACCGCCCCCAACCCCACCCCCCGCCACCCTCTCGGTAGTCAGCCGGATAAA...

Protein

Download Protein FASTA

404 aa · TkA02G282780|TK1151|PROTEIN

MTSAVIQDICFSPYSQWIAVVHQGGRVISFYIPFGGGETGIQLQNSKTTGSLPFVSLPWWSTCSFSKDQPPPPTPPPATLSVVSRIKNVNFGWINTGKAAVPPGVIAATFHSSVCRNPEPSGDVLEHLLVYTPSGYVIQYELLLPSSGREVKESGGGAQDEELRVKVEPVQWWDVCRRMDWPEKEEFIGGGGGGGGPVMNSNSEVRWYLSHAEVQMRSGRVPIWQKSKIYFYVMTPQEVNEDGGEVDIETMGVQEIEVRE...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G282780`
TK1151 ID	TkA02G282780
OH-1004 ID	LXL04_016020
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	94.100
Protein coverage (%)	TK1151 100.000 / OH-1004 48.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G282780

Location Chr02:72146548-72151715 (-)

Description Similar to ATG18H: Autophagy-related protein 18h

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g54710`	The PI(3,5)P2 regulatory complex regulates both the synthesis and turnover of phosphatidylinositol 3,5-bisphosphate (PtdIns(3,5)P2).	No verified direct reference in this release
`At1g03380`	The PI(3,5)P2 regulatory complex regulates both the synthesis and turnover of phosphatidylinositol 3,5-bisphosphate (PtdIns(3,5)P2).	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_016020 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006914 autophagy Biological Process

GO:0007267 cell-cell signaling Biological Process

GO:0010595 positive regulation of endothelial cell migration Biological Process

GO:0015031 protein transport Biological Process

GO:0032956 regulation of actin cytoskeleton organization Biological Process

GO:0042594 response to starvation Biological Process

GO:0043085 positive regulation of catalytic activity Biological Process

GO:0043627 response to estrogen Biological Process

GO:0045944 positive regulation of transcription by RNA polymerase II Biological Process

GO:0071391 cellular response to estrogen stimulus Biological Process

GO:0000407 phagophore assembly site Cellular Component

KEGG gene cross-reference

ath:AT1G03380

ath:AT1G54710

ath:AT5G54730

hsa:54828

mmu:192197

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.794

Rank 1 · TkA02G282780 · TK1151

Cytoplasm0.187

Rank 2 · TkA02G282780 · TK1151

Cell membrane0.075

Rank 3 · TkA02G282780 · TK1151

Endoplasmic reticulum0.056

Rank 4 · TkA02G282780 · TK1151

Lysosome / Vacuole0.041

Rank 5 · TkA02G282780 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF21034BCAS3_WD402-36 aa

PF12490BCAS3158-190 aa

PF12490BCAS3200-268 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G282780	`PF21034`	BCAS3_WD40	2	36	0.28	10.5
TkA02G282780	`PF12490`	BCAS3	158	190	2.3e-34	119.4
TkA02G282780	`PF12490`	BCAS3	200	268	2.3e-34	119.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8H1Q5`	Arabidopsis thaliana	sp\|Q8H1Q5\|AT18H_ARATH Autophagy-related protein 18h	44.500%	Swiss-Prot	Medium
`Q8GUL1`	Arabidopsis thaliana	sp\|Q8GUL1\|AT18G_ARATH Autophagy-related protein 18g	40.200%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card