Gene Card
Gene overview
cDNA / CDS / Protein Sequences
483 bp · TkA02G265550|TK1151|cDNA
AAATTCGAAAAAAAACCGATTGTATGGGAAATACTTCAGGAAATTCTGGATGACCATCCTGTATTGCTGAATAGAGCGCCTACTCTGCATAGATTAGGCATACAGGCATTCCTCCCCGTTTTAGTAGAGGGGCGCGCTATTTGTTTACATCCATTAGTTTGTAAGGGCTTCAATGCAGACTTTGACGGGGATCAAATGGCTGTTCATGTGCCTTTATCTTTGGAGGCTCAAGCAGAGGCACGTTTACTTATGTTTTCTCA...
483 bp · TkA02G265550|TK1151|CDS
AAATTCGAAAAAAAACCGATTGTATGGGAAATACTTCAGGAAATTCTGGATGACCATCCTGTATTGCTGAATAGAGCGCCTACTCTGCATAGATTAGGCATACAGGCATTCCTCCCCGTTTTAGTAGAGGGGCGCGCTATTTGTTTACATCCATTAGTTTGTAAGGGCTTCAATGCAGACTTTGACGGGGATCAAATGGCTGTTCATGTGCCTTTATCTTTGGAGGCTCAAGCAGAGGCACGTTTACTTATGTTTTCTCA...
Protein
Download Protein FASTA160 aa · TkA02G265550|TK1151|PROTEIN
KFEKKPIVWEILQEILDDHPVLLNRAPTLHRLGIQAFLPVLVEGRAICLHPLVCKGFNADFDGDQMAVHVPLSLEAQAEARLLMFSHKNLLSPTIGDPISTPTQDMLSGLYVLTSGNRRGICVNRYNPCNRRNYQNEDNNSKYTKKTSEGRLECQQASII
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA02G265550 |
|---|---|
| TK1151 ID | TkA02G265550 |
| OH-1004 ID | LXL04_036490 |
| Relationship / confidence | Non Reciprocal Best Hit / Complex relationship |
| Protein identity (%) | 41.500 |
| Protein coverage (%) | TK1151 58.750 / OH-1004 6.690Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA02G265550 |
|---|---|
| Location | Chr02:68000459-68000941 (+) |
| Description | Similar to NRPC1: DNA-directed RNA polymerase III subunit 1 |
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene ArabidopsisNo hit for this species in the current source table. RiceNo hit for this species in the current source table. |
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · |
| GO annotations (OH1004 source) | GO:0006351 DNA-templated transcription Biological Process GO:0006383 transcription by RNA polymerase III Biological Process GO:0006384 transcription initiation at RNA polymerase III promoter Biological Process GO:0006386 termination of RNA polymerase III transcription Biological Process GO:0032728 positive regulation of interferon-beta production Biological Process GO:0042797 tRNA transcription by RNA polymerase III Biological Process GO:0045087 innate immune response Biological Process GO:0051607 defense response to virus Biological Process GO:0000428 DNA-directed RNA polymerase complex Cellular Component GO:0000785 chromatin Cellular Component GO:0005634 nucleus Cellular Component GO:0005654 nucleoplasm Cellular Component |
| KEGG gene cross-reference | ath:AT5G60040 bta:540308 dha:DEHA2G12980g sce:YOR116C spo:2541094 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF00623RNA_pol_Rpb1_210-84 aaPF04983RNA_pol_Rpb1_389-125 aaPF10836DUF257491-127 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| TkA02G265550 | PF00623 | RNA_pol_Rpb1_2 | 10 | 84 | 3.8e-27 | 96.3 |
| TkA02G265550 | PF04983 | RNA_pol_Rpb1_3 | 89 | 125 | 1.9e-06 | 28.6 |
| TkA02G265550 | PF10836 | DUF2574 | 91 | 127 | 0.12 | 13.0 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.
No result was found for this query.