LXL04_036490 | RubberDandelionOmics

Gene overview

LXL04_036490

Reference: OH-1004 Chr: Chr08 Coordinates: 43265549-43272555 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

4218 bp · LXL04_036490|LXL04_036490|OH1004|cDNA

ATGGCACATGCGATGAATAGAAACAGAGGACAAGAAACCACCCTCACATTCACGAAACATCCTTATGTCGAAGATAAAGGCCCCCGAAGGATCGAGAGCATTAAGTTCTCGATGTTTTCTGACTCCGATGTTCTCAAAATGGGGGAAGTTCAGGTTTCGTGCTCCCGATGTTACGTGAGTCAAGAGGACAAAAGCCCTGTTGCCAATGGATTACTGGATGCACATATGGGTCCTCCAAACAAGCAAGGCACATGTGAGAC...

CDS

Download CDS FASTA

4218 bp · LXL04_036490|LXL04_036490|OH1004|CDS

ATGGCACATGCGATGAATAGAAACAGAGGACAAGAAACCACCCTCACATTCACGAAACATCCTTATGTCGAAGATAAAGGCCCCCGAAGGATCGAGAGCATTAAGTTCTCGATGTTTTCTGACTCCGATGTTCTCAAAATGGGGGAAGTTCAGGTTTCGTGCTCCCGATGTTACGTGAGTCAAGAGGACAAAAGCCCTGTTGCCAATGGATTACTGGATGCACATATGGGTCCTCCAAACAAGCAAGGCACATGTGAGAC...

Protein

Download Protein FASTA

1405 aa · LXL04_036490|LXL04_036490|OH1004|PROTEIN

MAHAMNRNRGQETTLTFTKHPYVEDKGPRRIESIKFSMFSDSDVLKMGEVQVSCSRCYVSQEDKSPVANGLLDAHMGPPNKQGTCETCHGKFENCPGHFGYLTLALPVFNVGYLSHIIDILKCICKSCARILLVEEERVGVLKKMRNPKLDHLRKNETFKKVVKRCTAMVSSKKAVKCSRCGYINGIVKKLAGTVAVVHDRSHVQENSLKDSKGAIKQMKESKPSVTFLPHLNPDKVLKLFKKMLDEDCDLLYLADRPEK...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_036490`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_036490

Location Chr08:43265549-43272555 (+)

Description Similar to NRPC1: DNA-directed RNA polymerase III subunit 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g60040`	DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_036490 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006383 transcription by RNA polymerase III Biological Process

GO:0006384 transcription initiation at RNA polymerase III promoter Biological Process

GO:0006386 termination of RNA polymerase III transcription Biological Process

GO:0032728 positive regulation of interferon-beta production Biological Process

GO:0042797 tRNA transcription by RNA polymerase III Biological Process

GO:0045087 innate immune response Biological Process

GO:0051607 defense response to virus Biological Process

GO:0000428 DNA-directed RNA polymerase complex Cellular Component

GO:0000785 chromatin Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005654 nucleoplasm Cellular Component

KEGG gene cross-reference

ath:AT5G60040

bta:540308

dha:DEHA2G12980g

sce:YOR116C

spo:2541094

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.909

Rank 1 · LXL04_036490 · OH-1004

Cytoplasm0.131

Rank 2 · LXL04_036490 · OH-1004

Mitochondrion0.029

Rank 3 · LXL04_036490 · OH-1004

Cell membrane0.022

Rank 4 · LXL04_036490 · OH-1004

Endoplasmic reticulum0.010

Rank 5 · LXL04_036490 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF04997.18RNA_pol_Rpb1_129-371 aa

PF00623.26RNA_pol_Rpb1_2373-539 aa

PF04983.24RNA_pol_Rpb1_3542-721 aa

PF05000.23RNA_pol_Rpb1_4750-852 aa

PF04998.23RNA_pol_Rpb1_5859-1339 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_036490	`PF04997.18`	RNA_pol_Rpb1_1	29	371	1e-74	252.5
LXL04_036490	`PF00623.26`	RNA_pol_Rpb1_2	373	539	2.3e-73	246.7
LXL04_036490	`PF04983.24`	RNA_pol_Rpb1_3	542	721	3.1e-39	135.2
LXL04_036490	`PF05000.23`	RNA_pol_Rpb1_4	750	852	8.9e-33	113.1
LXL04_036490	`PF04998.23`	RNA_pol_Rpb1_5	859	1339	1.6e-89	300.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`F4JXF9`	Arabidopsis thaliana	DNA-directed RNA polymerase III subunit 1	62.509%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card