TkA02G262660 | RubberDandelionOmics

Gene overview

TkA02G262660

Reference: TK1151 Chr: Chr02 Coordinates: 67269685-67270094 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

369 bp · TkA02G262660|TK1151|cDNA

ATGGCGGTGAGTTTCAATGAAAACGATAAAGATTATGTCAACTCTACTGTGGTTGAAGCTGTTGAGGTCAAAAGTGGCCCTGATGGATTTGTGATTAAGACGAGAGATGGAAAGCATTTAAGATGTGCTCATAACAACCCTCAAGGTGGACATCTCCCTAATTATGCACCACATCCTGCAACTGTACTAACGATGGAAGATGGGACTGGCCTTCTTCTTCCTATAATCGTTTTGTATATCATAACTGATAGAATTTCGAG...

CDS

Download CDS FASTA

369 bp · TkA02G262660|TK1151|CDS

ATGGCGGTGAGTTTCAATGAAAACGATAAAGATTATGTCAACTCTACTGTGGTTGAAGCTGTTGAGGTCAAAAGTGGCCCTGATGGATTTGTGATTAAGACGAGAGATGGAAAGCATTTAAGATGTGCTCATAACAACCCTCAAGGTGGACATCTCCCTAATTATGCACCACATCCTGCAACTGTACTAACGATGGAAGATGGGACTGGCCTTCTTCTTCCTATAATCGTTTTGTATATCATAACTGATAGAATTTCGAG...

Protein

Download Protein FASTA

122 aa · TkA02G262660|TK1151|PROTEIN

MAVSFNENDKDYVNSTVVEAVEVKSGPDGFVIKTRDGKHLRCAHNNPQGGHLPNYAPHPATVLTMEDGTGLLLPIIVLYIITDRISRVTPDIAVIESFTQYRYQPLLDFCLLYRQRCQIVLR

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G262660`
TK1151 ID	TkA02G262660
OH-1004 ID	LXL04_038098
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	89.100
Protein coverage (%)	TK1151 82.787 / OH-1004 87.611 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G262660

Location Chr02:67269685-67270094 (+)

Description Similar to BBD1: Bifunctional nuclease 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g75380`	Bifunctional nuclease with both RNase and DNase activities.	Novel bifunctional nucleases, OmBBD and AtBBD1, are involved in abscisic acid-mediated callose deposition in Arabidopsis.2010 · DOI: 10.1104/pp.109.147645
`At1g19660`	Bifunctional nuclease with both RNase and DNase activities.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os08g0357000`	Bifunctional nuclease with both RNase and DNase activities.	No verified direct reference in this release
`UniProt: B8A8D2`	Bifunctional nuclease with both RNase and DNase activities.	No verified direct reference in this release
`Os01g0702000`	Bifunctional nuclease with both RNase and DNase activities.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_038098 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009414 response to water deprivation Biological Process

GO:0009738 abscisic acid-activated signaling pathway Biological Process

GO:0010119 regulation of stomatal movement Biological Process

GO:0016567 protein ubiquitination Biological Process

GO:0050832 defense response to fungus Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0030891 VCB complex Cellular Component

GO:0004518 nuclease activity Molecular Function

GO:0004530 deoxyribonuclease I activity Molecular Function

GO:0004540 RNA nuclease activity Molecular Function

GO:0016787 hydrolase activity Molecular Function

KEGG gene cross-reference

ath:AT1G19660

ath:AT1G75380

dosa:Os01g0702000

dosa:Os08g0357000

osa:4326932

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.421

Rank 1 · TkA02G262660 · TK1151

Nucleus0.390

Rank 2 · TkA02G262660 · TK1151

Mitochondrion0.132

Rank 3 · TkA02G262660 · TK1151

Extracellular0.104

Rank 4 · TkA02G262660 · TK1151

Cell membrane0.066

Rank 5 · TkA02G262660 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

No result was found for this query.

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FWS6`	Arabidopsis thaliana	sp\|Q9FWS6\|BBD1_ARATH Bifunctional nuclease 1	80.500%	Swiss-Prot	Medium
`Q93VH2`	Arabidopsis thaliana	sp\|Q93VH2\|BBD2_ARATH Bifunctional nuclease 2	77.900%	Swiss-Prot	Medium
`Q6YZM6`	Oryza sativa subsp. japonica	sp\|Q6YZM6\|BBD2_ORYSJ Bifunctional nuclease 2	66.700%	Swiss-Prot	Medium
`B8A8D2`	Oryza sativa subsp. indica	sp\|B8A8D2\|BBD1_ORYSI Bifunctional nuclease 1	57.100%	Swiss-Prot	Medium
`Q5N8J3`	Oryza sativa subsp. japonica	sp\|Q5N8J3\|BBD1_ORYSJ Bifunctional nuclease 1	57.100%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card