TkA02G249930 | RubberDandelionOmics

Gene overview

TkA02G249930

Reference: TK1151 Chr: Chr02 Coordinates: 64074531-64075403 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

468 bp · TkA02G249930|TK1151|cDNA

ATGAAACCATGCCCTGAAACACCATACCTCTCTCTCCTCTCTGTATCTGGGTCAAAGAAACCATACCTCTCTGCCCCCATCTCAATCAATCTTCCATATGTGAAGAAGGTCGAAGTTCAAGGGTTTGGGGGTTTCGCCTTTTCTGAATCGGTGATCTTCAAATCTCTTGTATCAGTAAGCCATCAACGGTCAAACAAGATGAACAAGCAAGACTTCATGAAGCTACAGACTTGTGTCCTCAGAGTAAATATACAGTGCGC...

CDS

Download CDS FASTA

468 bp · TkA02G249930|TK1151|CDS

ATGAAACCATGCCCTGAAACACCATACCTCTCTCTCCTCTCTGTATCTGGGTCAAAGAAACCATACCTCTCTGCCCCCATCTCAATCAATCTTCCATATGTGAAGAAGGTCGAAGTTCAAGGGTTTGGGGGTTTCGCCTTTTCTGAATCGGTGATCTTCAAATCTCTTGTATCAGTAAGCCATCAACGGTCAAACAAGATGAACAAGCAAGACTTCATGAAGCTACAGACTTGTGTCCTCAGAGTAAATATACAGTGCGC...

Protein

Download Protein FASTA

155 aa · TkA02G249930|TK1151|PROTEIN

MKPCPETPYLSLLSVSGSKKPYLSAPISINLPYVKKVEVQGFGGFAFSESVIFKSLVSVSHQRSNKMNKQDFMKLQTCVLRVNIQCACDGCKQKIKKLLNKVDGNAHSSITKLKPALHWEGNERGVDYSLTYNQLLDKVSQILLFKELWIANRRS

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G249930`
TK1151 ID	TkA02G249930
OH-1004 ID	LXL04_015511
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	95.800
Protein coverage (%)	TK1151 92.903 / OH-1004 22.606 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G249930

Location Chr02:64074531-64075403 (-)

Description Similar to ACS: Acetyl-coenzyme A synthetase, chloroplastic/glyoxysomal

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g06130`	Heavy-metal-binding protein.	No verified direct reference in this release
`At5g19090`	Heavy-metal-binding protein.	No verified direct reference in this release
`At3g05220`	Heavy-metal-binding protein.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_015511 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006068 ethanol catabolic process Biological Process

GO:0006083 acetate metabolic process Biological Process

GO:0006085 acetyl-CoA biosynthetic process Biological Process

GO:0006351 DNA-templated transcription Biological Process

GO:0006631 fatty acid metabolic process Biological Process

GO:0006935 chemotaxis Biological Process

GO:0008610 lipid biosynthetic process Biological Process

GO:0019413 acetate biosynthetic process Biological Process

GO:0019427 acetyl-CoA biosynthetic process from acetate Biological Process

GO:0019542 propionate biosynthetic process Biological Process

GO:0045494 photoreceptor cell maintenance Biological Process

GO:0005634 nucleus Cellular Component

KEGG gene cross-reference

ath:AT5G36880

dme:Dmel_CG9390

hsa:55902

mmu:60525

plu:plu0074

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.381

Rank 1 · TkA02G249930 · TK1151

Cytoplasm0.363

Rank 2 · TkA02G249930 · TK1151

Cell membrane0.147

Rank 3 · TkA02G249930 · TK1151

Mitochondrion0.123

Rank 4 · TkA02G249930 · TK1151

Endoplasmic reticulum0.123

Rank 5 · TkA02G249930 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00336DNA_pol_viral_C5-23 aa

PF00403HMA31-40 aa

PF00336DNA_pol_viral_C63-140 aa

PF00403HMA87-109 aa

PF09373PMBR127-147 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G249930	`PF00336`	DNA_pol_viral_C	5	23	0.045	13.9
TkA02G249930	`PF00403`	HMA	31	40	0.004	18.2
TkA02G249930	`PF00336`	DNA_pol_viral_C	63	140	0.045	13.9
TkA02G249930	`PF00403`	HMA	87	109	0.004	18.2
TkA02G249930	`PF09373`	PMBR	127	147	0.073	13.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9M8K5`	Arabidopsis thaliana	sp\|Q9M8K5\|HIP32_ARATH Heavy metal-associated isoprenylated plant protein 32	65.800%	Swiss-Prot	Low
`F4JZL7`	Arabidopsis thaliana	sp\|F4JZL7\|HIP33_ARATH Heavy metal-associated isoprenylated plant protein 33	65.800%	Swiss-Prot	Low
`Q0WV37`	Arabidopsis thaliana	sp\|Q0WV37\|HIP34_ARATH Heavy metal-associated isoprenylated plant protein 34	65.800%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card