LXL04_015511 | RubberDandelionOmics

Gene overview

LXL04_015511

Reference: OH-1004 Chr: Chr03 Coordinates: 74273568-74277411 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1914 bp · LXL04_015511|LXL04_015511|OH1004|cDNA

ATGAAGCCATGCCCTGGAACACCATACCTCTCTCTCCTCTCTGTATCTGGGTCAAAGAAACCATACCTCTCTGCCCTCATCTCAATCAATCTTCCATATGTGAAGAAGGTCGAAGTTCAAGGGTTTGGGGGATTCGCCTTTTCTGAATCGGTGATCTTCAAATCTCTTGTATCAGTAAGCTATCAACGGTCAAACAAGATGAACAAGCAAGACTTCATGAAGCTACAGACTTGTGTCCTCAGAGTAAATATACAGTGCGC...

CDS

Download CDS FASTA

1914 bp · LXL04_015511|LXL04_015511|OH1004|CDS

ATGAAGCCATGCCCTGGAACACCATACCTCTCTCTCCTCTCTGTATCTGGGTCAAAGAAACCATACCTCTCTGCCCTCATCTCAATCAATCTTCCATATGTGAAGAAGGTCGAAGTTCAAGGGTTTGGGGGATTCGCCTTTTCTGAATCGGTGATCTTCAAATCTCTTGTATCAGTAAGCTATCAACGGTCAAACAAGATGAACAAGCAAGACTTCATGAAGCTACAGACTTGTGTCCTCAGAGTAAATATACAGTGCGC...

Protein

Download Protein FASTA

637 aa · LXL04_015511|LXL04_015511|OH1004|PROTEIN

MKPCPGTPYLSLLSVSGSKKPYLSALISINLPYVKKVEVQGFGGFAFSESVIFKSLVSVSYQRSNKMNKQDFMKLQTCVLRVNIQCACDGCKQKIKKLLNKVDGNAHSSITKLKPALHWEGNEPGVDYSLTYNQLLDKVSQIVITCNAIKRGKKVINLKDIVDSALSESSQNGVSVGLCLTYANDSAMKKETTKWQKERDAWWQDVIPEYSTKCDVEWVDAEDPLFLLYTSGSTGKPKGVAHTTGGYMVYTATTFKYAFD...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_015511`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_015511

Location Chr03:74273568-74277411 (-)

Description Similar to ACS: Acetyl-coenzyme A synthetase, chloroplastic/glyoxysomal

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g36880`	Catalyzes the production of acetyl-CoA, an activated form of acetate that can be used for lipid synthesis or for energy generation.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_015511 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006068 ethanol catabolic process Biological Process

GO:0006083 acetate metabolic process Biological Process

GO:0006085 acetyl-CoA biosynthetic process Biological Process

GO:0006351 DNA-templated transcription Biological Process

GO:0006631 fatty acid metabolic process Biological Process

GO:0006935 chemotaxis Biological Process

GO:0008610 lipid biosynthetic process Biological Process

GO:0019413 acetate biosynthetic process Biological Process

GO:0019427 acetyl-CoA biosynthetic process from acetate Biological Process

GO:0019542 propionate biosynthetic process Biological Process

GO:0045494 photoreceptor cell maintenance Biological Process

GO:0005634 nucleus Cellular Component

KEGG gene cross-reference

ath:AT5G36880

dme:Dmel_CG9390

hsa:55902

mmu:60525

plu:plu0074

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.882

Rank 1 · LXL04_015511 · OH-1004

Cytoplasm0.152

Rank 2 · LXL04_015511 · OH-1004

Cell membrane0.034

Rank 3 · LXL04_015511 · OH-1004

Mitochondrion0.029

Rank 4 · LXL04_015511 · OH-1004

Extracellular0.029

Rank 5 · LXL04_015511 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00501.35AMP-binding164-265 aa

PF08766.17DEK_C563-615 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_015511	`PF00501.35`	AMP-binding	164	265	1.2e-15	58.0
LXL04_015511	`PF08766.17`	DEK_C	563	615	1.7e-09	38.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`B9DGD6`	Arabidopsis thaliana	Acetyl-coenzyme A synthetase, chloroplastic/glyoxysomal	70.455%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card