TkA02G197130 | RubberDandelionOmics

Gene overview

TkA02G197130

Reference: TK1151 Chr: Chr02 Coordinates: 50491957-50494222 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

957 bp · TkA02G197130|TK1151|cDNA

ATGTCAGAAAGCCTCTCAGATTCTGATACTGCCATGCTTGAATTTGTTCGGAAACACCTTCTTGAGGAAGCTGACAGCTCTTACCCTTTTCCGGCGAAGAATACGCCCTTTGACGAACAAGATTACAGCCGGAGTTCAAGCTTCACAAGCCCTTTTTCATTCGATATATCAATCAAACAATCATTCTGTGTCGATTCATATGTTGATTCTCTTTCTTCTGTAATAACTTCTTCCAATTCCAGGGTGTGTAGCCCTAGCAA...

CDS

Download CDS FASTA

957 bp · TkA02G197130|TK1151|CDS

ATGTCAGAAAGCCTCTCAGATTCTGATACTGCCATGCTTGAATTTGTTCGGAAACACCTTCTTGAGGAAGCTGACAGCTCTTACCCTTTTCCGGCGAAGAATACGCCCTTTGACGAACAAGATTACAGCCGGAGTTCAAGCTTCACAAGCCCTTTTTCATTCGATATATCAATCAAACAATCATTCTGTGTCGATTCATATGTTGATTCTCTTTCTTCTGTAATAACTTCTTCCAATTCCAGGGTGTGTAGCCCTAGCAA...

Protein

Download Protein FASTA

318 aa · TkA02G197130|TK1151|PROTEIN

MSESLSDSDTAMLEFVRKHLLEEADSSYPFPAKNTPFDEQDYSRSSSFTSPFSFDISIKQSFCVDSYVDSLSSVITSSNSRVCSPSNSVINPIFTDNSRKRSCSESTIFQVTNWEGGSALINSPRSPIPMEEDQFKVDFSLGKVEKLQKNDQKSNDWRRFRGVRRRPWGKFAAEIKNPCKKGSRIWLGTFSTPEEAALAYDQAAFKIRGSRAMVAIGDAEDTRFWEDRWQELGTLKTVCPRLYALEAQKCIKFRNRINSG...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G197130`
TK1151 ID	TkA02G197130
OH-1004 ID	LXL04_035339
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	49.500
Protein coverage (%)	TK1151 33.019 / OH-1004 7.212 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G197130

Location Chr02:50491957-50494222 (+)

Description Similar to At5g07670: F-box protein At5g07670

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g07580`	Probably acts as a transcriptional activator.	No verified direct reference in this release
`At4g17500`	Acts as a transcriptional activator.	No verified direct reference in this release
`At5g51190`	Probably acts as a transcriptional activator.	No verified direct reference in this release
`At2g44840`	Acts as a transcriptional activator.	No verified direct reference in this release
`At3g23230`	Probably acts as a transcriptional activator.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_035339 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0031146 SCF-dependent proteasomal ubiquitin-dependent protein catabolic process Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0019005 SCF ubiquitin ligase complex Cellular Component

GO:0005524 ATP binding Molecular Function

GO:0016301 kinase activity Molecular Function

GO:0016774 phosphotransferase activity, carboxyl group as acceptor Molecular Function

KEGG gene cross-reference

ath:AT5G07670

ath:AT5G51370

ath:AT5G51380

pfu:PF0078

pho:PH0149

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.921

Rank 1 · TkA02G197130 · TK1151

Cytoplasm0.141

Rank 2 · TkA02G197130 · TK1151

Cell membrane0.030

Rank 3 · TkA02G197130 · TK1151

Plastid0.022

Rank 4 · TkA02G197130 · TK1151

Endoplasmic reticulum0.019

Rank 5 · TkA02G197130 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00847AP2159-210 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G197130	`PF00847`	AP2	159	210	7.7e-16	58.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LY05`	Arabidopsis thaliana	sp\|Q9LY05\|EF106_ARATH Ethylene-responsive transcription factor ERF106	46.400%	Swiss-Prot	Low
`O80337`	Arabidopsis thaliana	sp\|O80337\|EF100_ARATH Ethylene-responsive transcription factor 1A	36.700%	Swiss-Prot	Low
`Q8VY90`	Arabidopsis thaliana	sp\|Q8VY90\|EF105_ARATH Ethylene-responsive transcription factor ERF105	68.300%	Swiss-Prot	Low
`Q8L9K1`	Arabidopsis thaliana	sp\|Q8L9K1\|ERF99_ARATH Ethylene-responsive transcription factor 13	69.100%	Swiss-Prot	Low
`Q9LTC5`	Arabidopsis thaliana	sp\|Q9LTC5\|ERF98_ARATH Ethylene-responsive transcription factor ERF098	63.600%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card