LXL04_035339 | RubberDandelionOmics

Gene overview

LXL04_035339

Reference: OH-1004 Chr: Chr08 Coordinates: 20580122-20589523 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

4371 bp · LXL04_035339|LXL04_035339|OH1004|cDNA

ATGTTCAAGACCGACATCAGCAAAGCCTATGACTCGGTATCTTGGAAATACCTAGATACAATGATGGAAGCTATGAACTTTGGGGAAAAATGGAGAAATTGGATACACGCATGCCTTGCTTCTAGTGCAATGTCGGTGCTAGTTAATGGATCCCCGACTTTTGAATTTGTTATGGAACGTGGCCTGAGACAAGGAGATCCCATATCCCCTTTTTTGTTTACCCTTATCATGGAAGGGCTAAGCCTTGCTGTCAACAAAGC...

CDS

Download CDS FASTA

4371 bp · LXL04_035339|LXL04_035339|OH1004|CDS

ATGTTCAAGACCGACATCAGCAAAGCCTATGACTCGGTATCTTGGAAATACCTAGATACAATGATGGAAGCTATGAACTTTGGGGAAAAATGGAGAAATTGGATACACGCATGCCTTGCTTCTAGTGCAATGTCGGTGCTAGTTAATGGATCCCCGACTTTTGAATTTGTTATGGAACGTGGCCTGAGACAAGGAGATCCCATATCCCCTTTTTTGTTTACCCTTATCATGGAAGGGCTAAGCCTTGCTGTCAACAAAGC...

Protein

Download Protein FASTA

1456 aa · LXL04_035339|LXL04_035339|OH1004|PROTEIN

MFKTDISKAYDSVSWKYLDTMMEAMNFGEKWRNWIHACLASSAMSVLVNGSPTFEFVMERGLRQGDPISPFLFTLIMEGLSLAVNKAVENGMFKDLKVGKDNISVSHLFFADDAVFLGEWTLDNAICMINVLMCFRRASSLRVNYQKSSLFGIGVDTDSISSMANLLGCKADKLPEIFLGGRLTIVCNILGGIPNYWLSMFPMPKGAIKKLENMRQDFFWGPKEAGRPIPWVKWSKACQQRKNGGLGIIGIEEMNLYLLA...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_035339`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_035339

Location Chr08:20580122-20589523 (-)

Description Similar to At5g07670: F-box protein At5g07670

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g07670`	F-box protein At5g07670.	No verified direct reference in this release
`At5g51380`	F-box protein At5g51380.	No verified direct reference in this release
`At5g51370`	F-box protein At5g51370.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_035339 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0031146 SCF-dependent proteasomal ubiquitin-dependent protein catabolic process Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0019005 SCF ubiquitin ligase complex Cellular Component

GO:0005524 ATP binding Molecular Function

GO:0016301 kinase activity Molecular Function

GO:0016774 phosphotransferase activity, carboxyl group as acceptor Molecular Function

KEGG gene cross-reference

ath:AT5G07670

ath:AT5G51370

ath:AT5G51380

pfu:PF0078

pho:PH0149

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.375

Rank 1 · LXL04_035339 · OH-1004

Cytoplasm0.255

Rank 2 · LXL04_035339 · OH-1004

Cell membrane0.163

Rank 3 · LXL04_035339 · OH-1004

Plastid0.151

Rank 4 · LXL04_035339 · OH-1004

Endoplasmic reticulum0.063

Rank 5 · LXL04_035339 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00078.33RVT_13-151 aa

PF25372.2LRR_FBXL15815-1011 aa

PF13238.13AAA_181219-1317 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_035339	`PF00078.33`	RVT_1	3	151	7e-18	66.0
LXL04_035339	`PF25372.2`	LRR_FBXL15	815	1011	3.7e-07	29.6
LXL04_035339	`PF13238.13`	AAA_18	1219	1317	3.8e-07	31.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8VYT5`	Arabidopsis thaliana	F-box protein At5g07670	45.794%	Swiss-Prot	weak database homology
`Q9FGN3`	Arabidopsis thaliana	F-box protein At5g51380	43.064%	Swiss-Prot	weak database homology
`Q9FGN4`	Arabidopsis thaliana	F-box protein At5g51370	46.301%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card