TkA02G191920 | RubberDandelionOmics

Gene overview

TkA02G191920

Reference: TK1151 Chr: Chr02 Coordinates: 49202557-49202895 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

339 bp · TkA02G191920|TK1151|cDNA

ATGGCAGAACTTGAGTGTCCGTTGGTGATGAGCAAACTGATCGCCTACCTTTCATCTCTCCTCCAACAAGTAGCTGAATCTAATGATCTCAACCCCCACTTCCCCCCACAGAAGATCTCGGCCTTTCATGCTCTTACCAGGCCAACGATCACAATTCAGAGTTACTTAGAGAGGATTTTCAAGTACGCTAATTGTAGTCCTTCCTTCTATGTTATTGCATATGTTATCTCGATCGCTTTACTCAGCGACAGCCGCGCGCT...

CDS

Download CDS FASTA

339 bp · TkA02G191920|TK1151|CDS

ATGGCAGAACTTGAGTGTCCGTTGGTGATGAGCAAACTGATCGCCTACCTTTCATCTCTCCTCCAACAAGTAGCTGAATCTAATGATCTCAACCCCCACTTCCCCCCACAGAAGATCTCGGCCTTTCATGCTCTTACCAGGCCAACGATCACAATTCAGAGTTACTTAGAGAGGATTTTCAAGTACGCTAATTGTAGTCCTTCCTTCTATGTTATTGCATATGTTATCTCGATCGCTTTACTCAGCGACAGCCGCGCGCT...

Protein

Download Protein FASTA

112 aa · TkA02G191920|TK1151|PROTEIN

MAELECPLVMSKLIAYLSSLLQQVAESNDLNPHFPPQKISAFHALTRPTITIQSYLERIFKYANCSPSFYVIAYVISIALLSDSRALSINSFNVHRLLITSVMISAKFMDDM

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G191920`
TK1151 ID	TkA02G191920
OH-1004 ID	LXL04_033552
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	85.600
Protein coverage (%)	TK1151 99.107 / OH-1004 49.776 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G191920

Location Chr02:49202557-49202895 (+)

Description Similar to CYCU4-1: Cyclin-U4-1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g44740`	Cyclin-U4-1.	No verified direct reference in this release
`At5g07450`	Cyclin-U4-2.	No verified direct reference in this release
`At5g61650`	Cyclin-U4-3.	No verified direct reference in this release
`At3g21870`	Cyclin-U1-1.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os10g0563900`	Cyclin-P4-1.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_033552 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0051301 cell division Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0019901 protein kinase binding Molecular Function

KEGG gene cross-reference

ath:AT2G44740

ath:AT3G63120

ath:AT5G07450

ath:AT5G61650

dosa:Os10g0563900

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.721

Rank 1 · TkA02G191920 · TK1151

Cytoplasm0.446

Rank 2 · TkA02G191920 · TK1151

Mitochondrion0.038

Rank 3 · TkA02G191920 · TK1151

Endoplasmic reticulum0.018

Rank 4 · TkA02G191920 · TK1151

Cell membrane0.018

Rank 5 · TkA02G191920 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF14454Prok_Ub28-51 aa

PF08613Cyclin35-112 aa

PF00134Cyclin_N52-109 aa

PF14454Prok_Ub56-64 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G191920	`PF14454`	Prok_Ub	28	51	0.094	13.3
TkA02G191920	`PF08613`	Cyclin	35	112	2.4e-17	64.4
TkA02G191920	`PF00134`	Cyclin_N	52	109	0.018	15.5
TkA02G191920	`PF14454`	Prok_Ub	56	64	0.094	13.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O80513`	Arabidopsis thaliana	sp\|O80513\|CCU41_ARATH Cyclin-U4-1	67.500%	Swiss-Prot	High
`Q9LY16`	Arabidopsis thaliana	sp\|Q9LY16\|CCU42_ARATH Cyclin-U4-2	51.900%	Swiss-Prot	High
`Q9FKF6`	Arabidopsis thaliana	sp\|Q9FKF6\|CCU43_ARATH Cyclin-U4-3	51.900%	Swiss-Prot	High
`Q9LJ45`	Arabidopsis thaliana	sp\|Q9LJ45\|CCU11_ARATH Cyclin-U1-1	40.800%	Swiss-Prot	Medium
`Q7XC35`	Oryza sativa subsp. japonica	sp\|Q7XC35\|CCP41_ORYSJ Cyclin-P4-1	52.400%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card