LXL04_033552 | RubberDandelionOmics

Gene overview

LXL04_033552

Reference: OH-1004 Chr: Chr07 Coordinates: 47562905-47564528 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

672 bp · LXL04_033552|LXL04_033552|OH1004|cDNA

ATGGCAGAACTTGAGTGCCCGTCGGTGATGAGCAAACTGATCGCCTACCTTTCATCTCTCCTCCAACAAGTAGCTGAATCTAATGATCTCAACCCCCGCTTCCCCCCACAGAAGATCTCGGCCTTTCATGCTCTTACCAGGCCAACGATCTCAATTCAGAGCTATTTAGAGAGGATTTTCAAGTACGCTAATTGTAGTCCCTCTTGCTATGTTGTTGCATATGTTTATCTCGATCGCTTTACTCAGCAACAGTCGGCGCT...

CDS

Download CDS FASTA

672 bp · LXL04_033552|LXL04_033552|OH1004|CDS

ATGGCAGAACTTGAGTGCCCGTCGGTGATGAGCAAACTGATCGCCTACCTTTCATCTCTCCTCCAACAAGTAGCTGAATCTAATGATCTCAACCCCCGCTTCCCCCCACAGAAGATCTCGGCCTTTCATGCTCTTACCAGGCCAACGATCTCAATTCAGAGCTATTTAGAGAGGATTTTCAAGTACGCTAATTGTAGTCCCTCTTGCTATGTTGTTGCATATGTTTATCTCGATCGCTTTACTCAGCAACAGTCGGCGCT...

Protein

Download Protein FASTA

223 aa · LXL04_033552|LXL04_033552|OH1004|PROTEIN

MAELECPSVMSKLIAYLSSLLQQVAESNDLNPRFPPQKISAFHALTRPTISIQSYLERIFKYANCSPSCYVVAYVYLDRFTQQQSALSINSFNVHRLLITSVMIAAKFMDDIIRSDFAQIPNPSRWIRYYNNAYYAKVGGISTTEMNFLEVDFLFGLGFQLNVTPTTFHTYCSYLQKEMFLLQPSLNTQELPPPQSSSSSSYKSRSMKLLHYEDDQQQEVVAV

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_033552`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_033552

Location Chr07:47562905-47564528 (+)

Description Similar to CYCU4-1: Cyclin-U4-1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g44740`	Cyclin-U4-1.	No verified direct reference in this release
`At5g07450`	Cyclin-U4-2.	No verified direct reference in this release
`At5g61650`	Cyclin-U4-3.	No verified direct reference in this release
`At3g63120`	Cyclin-U3-1.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os10g0563900`	Cyclin-P4-1.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_033552 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0051301 cell division Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0019901 protein kinase binding Molecular Function

KEGG gene cross-reference

ath:AT2G44740

ath:AT3G63120

ath:AT5G07450

ath:AT5G61650

dosa:Os10g0563900

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.728

Rank 1 · LXL04_033552 · OH-1004

Cytoplasm0.385

Rank 2 · LXL04_033552 · OH-1004

Mitochondrion0.041

Rank 3 · LXL04_033552 · OH-1004

Plastid0.023

Rank 4 · LXL04_033552 · OH-1004

Cell membrane0.022

Rank 5 · LXL04_033552 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF08613.17Cyclin36-115 aa

PF00134.29Cyclin_N52-162 aa

PF08613.17Cyclin129-161 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_033552	`PF08613.17`	Cyclin	36	115	8.9e-37	127.5
LXL04_033552	`PF00134.29`	Cyclin_N	52	162	1.1e-10	42.0
LXL04_033552	`PF08613.17`	Cyclin	129	161	8.9e-37	127.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O80513`	Arabidopsis thaliana	Cyclin-U4-1	73.118%	Swiss-Prot	strong database homology
`Q9LY16`	Arabidopsis thaliana	Cyclin-U4-2	57.714%	Swiss-Prot	strong database homology
`Q9FKF6`	Arabidopsis thaliana	Cyclin-U4-3	52.174%	Swiss-Prot	strong database homology
`Q8LB60`	Arabidopsis thaliana	Cyclin-U3-1	48.252%	Swiss-Prot	moderate database homology
`Q7XC35`	Oryza sativa subsp. japonica	Cyclin-P4-1	50.235%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card