Gene Card
Gene overview
cDNA / CDS / Protein Sequences
1681 bp · TkA02G191760|TK1151|cDNA
CTTAATTACCATATAATAACAACAGGTTATGATCGATGGGATAGGCATATTTAATCTATGCCTAAAGAGTGATTTTATTTCAAGTGGATTTCTTCATTCCTCTCTATATGTGTTACTGGAGAATCTCATTTGTTCAAACTTCCAAGTCAGACATGCATCGGATGCTGTCTTACATGTCATTTCAGCTACATCCAGCTATCCAACTGTTGGCCACTTAGTTTTGGCAAATTCAGACTATGTAATCGACTCAATATGCAGGC...
3870 bp · TkA02G191760|TK1151|CDS
ATGATGATGATGTCAGAAGGAGAGGACGAACATCCAAGTGGTGGGTTTCTTCAACTTAAGGGATACTGCTTGGAGATGCTACAACTCGTCAAAAACCCTAACAACAAAAACAGCACCTCCACTATCTCTCATCTTCTTCAATTCATACGCTGTTGTTCTCCTCATGATCTCCAATCGTTCTTCGACTATACATTGTTCCCTCTATTGCTTCTGTTGGAAGCTGCAGTAAACTGCAGATCATCATCAAATGATAAGTTAAA...
Protein
Download Protein FASTA1289 aa · TkA02G191760|TK1151|PROTEIN
MMMMSEGEDEHPSGGFLQLKGYCLEMLQLVKNPNNKNSTSTISHLLQFIRCCSPHDLQSFFDYTLFPLLLLLEAAVNCRSSSNDKLKEGEKPPKISDIVAEGVLQCLEELLIKCHLGSMEQMVVILKNLTNAALLSVTEASEEFREGVIRCFKALILGLRFCSNKSCKCNQINKTFSESVPVLEVNPNECLLAFLRSQSASVTVGHWLSLLLKAADVEAGRGQLGSSKLRVEAFMTLRVLVAKVGTPDQLAFFLPGVVSQ...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA02G191760 |
|---|---|
| TK1151 ID | TkA02G191760 |
| OH-1004 ID | LXL04_016109 |
| Relationship / confidence | Multi Source To Oh1004 / Complex relationship |
| Protein identity (%) | 98.100 |
| Protein coverage (%) | TK1151 100.000 / OH-1004 100.000Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA02G191760 |
|---|---|
| Location | Chr02:49152694-49159149 (-) |
| Description | Similar to Tti1: TELO2-interacting protein 1 homolog |
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene ArabidopsisNo hit for this species in the current source table. RiceNo hit for this species in the current source table. |
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · |
| GO annotations (OH1004 source) | GO:0032006 regulation of TOR signaling Biological Process GO:0050821 protein stabilization Biological Process GO:2000003 positive regulation of DNA damage checkpoint Biological Process GO:0005634 nucleus Cellular Component GO:0005737 cytoplasm Cellular Component GO:0031931 TORC1 complex Cellular Component GO:0031932 TORC2 complex Cellular Component GO:0110078 TTT Hsp90 cochaperone complex Cellular Component GO:0019900 kinase binding Molecular Function GO:0140777 protein-containing complex stabilizing activity Molecular Function |
| KEGG gene cross-reference | hsa:9675 mmu:75425 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF24173TPR_TTI1_N16-158 aaPF21547TTI1101-124 aaPF24173TPR_TTI1_N196-447 aaPF24181TPR_TTI1_C320-390 aaPF12717Cnd1406-489 aaPF26599MntS433-446 aaPF21547TTI1442-469 aaPF24176TPR_TTI1_2nd692-769 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| TkA02G191760 | PF24173 | TPR_TTI1_N | 16 | 158 | 4.3e-26 | 92.4 |
| TkA02G191760 | PF21547 | TTI1 | 101 | 124 | 9.5e-25 | 87.0 |
| TkA02G191760 | PF24173 | TPR_TTI1_N | 196 | 447 | 4.3e-26 | 92.4 |
| TkA02G191760 | PF24181 | TPR_TTI1_C | 320 | 390 | 1.8e-09 | 38.4 |
| TkA02G191760 | PF12717 | Cnd1 | 406 | 489 | 0.17 | 12.6 |
| TkA02G191760 | PF26599 | MntS | 433 | 446 | 0.16 | 12.2 |
| TkA02G191760 | PF21547 | TTI1 | 442 | 469 | 9.5e-25 | 87.0 |
| TkA02G191760 | PF24176 | TPR_TTI1_2nd | 692 | 769 | 1.8e-05 | 25.1 |
| TkA02G191760 | PF21547 | TTI1 | 812 | 902 | 9.5e-25 | 87.0 |
| TkA02G191760 | PF24181 | TPR_TTI1_C | 965 | 1220 | 1.8e-09 | 38.4 |
| TkA02G191760 | PF04945 | YHS | 1253 | 1277 | 0.25 | 12.1 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.
No result was found for this query.