LXL04_016109 | RubberDandelionOmics

Gene overview

LXL04_016109

Reference: OH-1004 Chr: Chr03 Coordinates: 110767379-110772901 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

3852 bp · LXL04_016109|LXL04_016109|OH1004|cDNA

ATGATGATGATGTCAGAAGGAGAGGACGAACATCCAAGTGGTGGGTTTCTTCAACTTAAGGGATACTGCTTGGAGATGCTACAACTCGTCAAAAACCCTAACAACAAAAACAGCACCTCCACTATCTCTCATCTTCTTCAATTCATACGCTGTTGTTCTCCTCATGATCTCCAATCGTTCTTCGACTATACATTGTTCCCTCTATTGCTTCTGTTGGAAGCTGCAGTAAACTGCAGATCATCATCAAATGATAAGTTAAA...

CDS

Download CDS FASTA

3852 bp · LXL04_016109|LXL04_016109|OH1004|CDS

ATGATGATGATGTCAGAAGGAGAGGACGAACATCCAAGTGGTGGGTTTCTTCAACTTAAGGGATACTGCTTGGAGATGCTACAACTCGTCAAAAACCCTAACAACAAAAACAGCACCTCCACTATCTCTCATCTTCTTCAATTCATACGCTGTTGTTCTCCTCATGATCTCCAATCGTTCTTCGACTATACATTGTTCCCTCTATTGCTTCTGTTGGAAGCTGCAGTAAACTGCAGATCATCATCAAATGATAAGTTAAA...

Protein

Download Protein FASTA

1283 aa · LXL04_016109|LXL04_016109|OH1004|PROTEIN

MMMMSEGEDEHPSGGFLQLKGYCLEMLQLVKNPNNKNSTSTISHLLQFIRCCSPHDLQSFFDYTLFPLLLLLEAAVNCRSSSNDKLKEGEKPPKISDIVAEGVLQCLEELLIKCHLGSMEQMVVILKNLTNAALLSVTEASEEFREGVIRCFKALILGLRFCSNKSCKCNQINKTFSESVPVLEVNPNECLLAFLRSQSASVTVGHWLSLLLKAADVEAGRGQLGSSKLRVEAFMTLRVLVAKVGTPDQLAFFLPGVVSQ...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_016109`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`LXL04_016109`
Location	Chr03:110767379-110772901 (+)
Description	Similar to Tti1: TELO2-interacting protein 1 homolog
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_016109` · GCA_047496595.1_OSU_TarKok_2.0.
GO annotations (OH1004 source)	GO:0032006 regulation of TOR signaling Biological Process GO:0050821 protein stabilization Biological Process GO:2000003 positive regulation of DNA damage checkpoint Biological Process GO:0005634 nucleus Cellular Component GO:0005737 cytoplasm Cellular Component GO:0031931 TORC1 complex Cellular Component GO:0031932 TORC2 complex Cellular Component GO:0110078 TTT Hsp90 cochaperone complex Cellular Component GO:0019900 kinase binding Molecular Function GO:0140777 protein-containing complex stabilizing activity Molecular Function
KEGG gene cross-reference	hsa:9675 mmu:75425 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.721

Rank 1 · LXL04_016109 · OH-1004

Cytoplasm0.221

Rank 2 · LXL04_016109 · OH-1004

Cell membrane0.079

Rank 3 · LXL04_016109 · OH-1004

Endoplasmic reticulum0.065

Rank 4 · LXL04_016109 · OH-1004

Golgi apparatus0.056

Rank 5 · LXL04_016109 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF24173.2TPR_TTI1_N16-158 aa

PF24173.2TPR_TTI1_N196-447 aa

PF24176.2TPR_TTI1_2nd692-763 aa

PF21547.4TTI1806-896 aa

PF24181.2TPR_TTI1_C951-1214 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_016109	`PF24173.2`	TPR_TTI1_N	16	158	4.4e-26	92.3
LXL04_016109	`PF24173.2`	TPR_TTI1_N	196	447	4.4e-26	92.3
LXL04_016109	`PF24176.2`	TPR_TTI1_2nd	692	763	9.4e-06	26.1
LXL04_016109	`PF21547.4`	TTI1	806	896	9.5e-25	87.0
LXL04_016109	`PF24181.2`	TPR_TTI1_C	951	1214	7.1e-10	39.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card