TkA02G189810 | RubberDandelionOmics

Gene overview

TkA02G189810

Reference: TK1151 Chr: Chr02 Coordinates: 48705846-48714827 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA No cDNA sequence available

cDNA

No cDNA sequence is available for this reference.

CDS

Download CDS FASTA

3855 bp · TkA02G189810|TK1151|CDS

ATGATGATGATGTCAGAAGGAGAGGACGAACATCCAAGTGGTGGGTTTCTTCAACTTAAGGGATACTGCTTGGAGATGCTACAAGTCGTCAAAAACCCTAACAACAAAAACAGCACCTCCACTATCTCTCATCTTCTTCAATTCATACGCTGTTGTTCTCCTCATGATCTCCAATCGTTCTTCGACTATACATTGTTCCCTCTATTGCTTCTGTTGGAAGCTGCAGTAAACTGCAGATCATCATCAAATGATAAGTTAAA...

Protein

Download Protein FASTA

1284 aa · TkA02G189810|TK1151|PROTEIN

MMMMSEGEDEHPSGGFLQLKGYCLEMLQVVKNPNNKNSTSTISHLLQFIRCCSPHDLQSFFDYTLFPLLLLLEAAVNCRSSSNDKLKEGEKPPKISDIVAEGVLQCLEELLIKCHLGSMEQMVVILKNLTNAALLSVTEASEEFREGVIRCFKALILGLRFCSNKSCKCNQINKTFSESVPVLEVNPNECLLAFLRSQSASVTVGHWLSLLLKAADVEAGRGQLGSSKLRVEAFMTLRVLVAKVGTPDQLAFFLPGVVSQ...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G189810`
TK1151 ID	TkA02G189810
OH-1004 ID	LXL04_016109
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	98.300
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA02G189810`
Location	Chr02:48705846-48714827 (-)
Description	Similar to Tti1: TELO2-interacting protein 1 homolog
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_016109` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0032006 regulation of TOR signaling Biological Process GO:0050821 protein stabilization Biological Process GO:2000003 positive regulation of DNA damage checkpoint Biological Process GO:0005634 nucleus Cellular Component GO:0005737 cytoplasm Cellular Component GO:0031931 TORC1 complex Cellular Component GO:0031932 TORC2 complex Cellular Component GO:0110078 TTT Hsp90 cochaperone complex Cellular Component GO:0019900 kinase binding Molecular Function GO:0140777 protein-containing complex stabilizing activity Molecular Function
KEGG gene cross-reference	hsa:9675 mmu:75425 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.713

Rank 1 · TkA02G189810 · TK1151

Cytoplasm0.219

Rank 2 · TkA02G189810 · TK1151

Cell membrane0.081

Rank 3 · TkA02G189810 · TK1151

Endoplasmic reticulum0.067

Rank 4 · TkA02G189810 · TK1151

Golgi apparatus0.058

Rank 5 · TkA02G189810 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF24173TPR_TTI1_N16-158 aa

PF21547TTI1101-124 aa

PF24173TPR_TTI1_N196-448 aa

PF26599MntS434-447 aa

PF21547TTI1441-469 aa

PF21547TTI1499-518 aa

PF24176TPR_TTI1_2nd693-764 aa

PF21547TTI1807-897 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G189810	`PF24173`	TPR_TTI1_N	16	158	4.9e-26	92.2
TkA02G189810	`PF21547`	TTI1	101	124	9.5e-25	87.0
TkA02G189810	`PF24173`	TPR_TTI1_N	196	448	4.9e-26	92.2
TkA02G189810	`PF26599`	MntS	434	447	0.18	12.0
TkA02G189810	`PF21547`	TTI1	441	469	9.5e-25	87.0
TkA02G189810	`PF21547`	TTI1	499	518	9.5e-25	87.0
TkA02G189810	`PF24176`	TPR_TTI1_2nd	693	764	1e-05	25.9
TkA02G189810	`PF21547`	TTI1	807	897	9.5e-25	87.0
TkA02G189810	`PF24181`	TPR_TTI1_C	958	1215	3.8e-09	37.3
TkA02G189810	`PF04945`	YHS	1248	1272	0.25	12.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card