TkA02G189800 | RubberDandelionOmics

Gene overview

TkA02G189800

Reference: TK1151 Chr: Chr02 Coordinates: 48700824-48705563 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2454 bp · TkA02G189800|TK1151|cDNA

TCTCCTATAGTAGTGGTTTAAGAAGTTGATTGGAACGACTCCTTGTGCTATTATGTGACCATTGTACCCTCAAAGTCAAAGAAATACCAAACAATTAAACATGGAATCACGAAGTCCCCTGATACGATCCCATGATCCAATACCCACGATCATCATAGAAGACTGGTTCCATTAAGCATGCATTTAGTTTCCCTTTTCTTAGGAAGATCATGTAGCCATTTACTTCCAGTACTTGCACGTTTCCCGTTCTAGTTAGTTGT...

CDS

Download CDS FASTA

1446 bp · TkA02G189800|TK1151|CDS

ATGGCACAGCTGTTGAAGAAAGTTTGGGAGTCGATTTCCAATGGTTGGACTTCGAGTGATTCTAGTTCAGACTCGCTATATAATTTTGACTACAGAGGTCCAGTTCATGGATCCCTATCGGATCAGATTATCATCTGTTCATCATCCACTGGGGCATTTGATCGATTTCCTCTAGATATATTTATGCAAATACTCAAGCTTCTTGGACCAAAAGAGGCGGCTAGGCTAACCTGCGTTTGCAAATCGTGGCAATTCATTAT...

Protein

Download Protein FASTA

481 aa · TkA02G189800|TK1151|PROTEIN

MAQLLKKVWESISNGWTSSDSSSDSLYNFDYRGPVHGSLSDQIIICSSSTGAFDRFPLDIFMQILKLLGPKEAARLTCVCKSWQFIISDNMLWIYFLQNQQEPWDSVFFGETNLRSGFPLRTYPRQMQSFMHIYGERAQVPGSIIIDGGAGYCKFGWSKYDSPSGRSATFVEFGNIESPLYARLRHFFATVYSRMRVRSSTQPVIISIPISHYDDTDADKAFRRRLKEAIHSALFGMNAPAVCAVSQATLALFSARRTSG...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G189800`
TK1151 ID	TkA02G189800
OH-1004 ID	LXL04_016110
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	99.400
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G189800

Location Chr02:48700824-48705563 (-)

Description Similar to ARP8: Actin-related protein 8

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g56180`	Actin-related protein 8.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`UniProt: A8WAT2`	Actin-related protein 8.	No verified direct reference in this release
`Os04g0667700`	Actin-related protein 8.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_016110 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0030029 actin filament-based process Biological Process

GO:0005634 nucleus Cellular Component

GO:0005730 nucleolus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005856 cytoskeleton Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0015629 actin cytoskeleton Cellular Component

GO:0005200 structural constituent of cytoskeleton Molecular Function

GO:0005524 ATP binding Molecular Function

GO:0016787 hydrolase activity Molecular Function

KEGG gene cross-reference

ath:AT5G56180

dosa:Os04g0667700

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.443

Rank 1 · TkA02G189800 · TK1151

Nucleus0.431

Rank 2 · TkA02G189800 · TK1151

Cell membrane0.101

Rank 3 · TkA02G189800 · TK1151

Mitochondrion0.098

Rank 4 · TkA02G189800 · TK1151

Endoplasmic reticulum0.051

Rank 5 · TkA02G189800 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00646F-box54-94 aa

PF12937F-box-like55-94 aa

PF00022Actin143-168 aa

PF06723MreB_Mbl184-425 aa

PF00022Actin233-470 aa

PF25229Salactin402-454 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G189800	`PF00646`	F-box	54	94	7.4e-09	35.9
TkA02G189800	`PF12937`	F-box-like	55	94	5.2e-09	36.4
TkA02G189800	`PF00022`	Actin	143	168	6.7e-41	140.9
TkA02G189800	`PF06723`	MreB_Mbl	184	425	0.00036	20.2
TkA02G189800	`PF00022`	Actin	233	470	6.7e-41	140.9
TkA02G189800	`PF25229`	Salactin	402	454	0.011	15.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FKT0`	Arabidopsis thaliana	sp\|Q9FKT0\|ARP8_ARATH Actin-related protein 8	58.500%	Swiss-Prot	High
`A8WAT2`	Oryza sativa subsp. indica	sp\|A8WAT2\|ARP8_ORYSI Actin-related protein 8	57.200%	Swiss-Prot	High
`Q7XR80`	Oryza sativa subsp. japonica	sp\|Q7XR80\|ARP8_ORYSJ Actin-related protein 8	57.200%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card