TkA02G185920 | RubberDandelionOmics

Gene overview

TkA02G185920

Reference: TK1151 Chr: Chr02 Coordinates: 47790545-47793629 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

751 bp · TkA02G185920|TK1151|cDNA

TGTTTAATACCCAGTTTGATTATAGCATTGAGATCATCTCAATTTTAACAAATATAATTTACGGTCGTTCATATGCAAATGAAAACAAAAAGGATGGTGTAGGGGACTGGAACTCCTGTGCTACCCTTTAAATTTATTCAATAAATAGACAAAGAAATTGGATGTTGCTGATTCCAGTAAAAATTGGCAATGGCTATTTGAAGAATTTGGGGAAACAGAAGAAAATAGAGAATTTTACTAAATCAATTAACGAATAAGGT...

CDS

Download CDS FASTA

312 bp · TkA02G185920|TK1151|CDS

ATGGAAATAACAGCATTCCTGGAGCCTCTAGTTATTTTCCTGATACTAATCGTTAACGCCATGGTCAATGTTTGGCAAGAAAACAACGATGAAAAAGCCCTAGAAGCGCTCAAAGAAATCCAGTCAGATCAAGCAAGTGTGATACATAATGAAAATTGCAGTGATATTGGGGTAATTTCATGCTGGTTACTTGCTTCCTCAATGAAATGTCTATATCATATTCATCTGTTCTGTACGTTCTTGCTTTCCTTCTGCATAAT...

Protein

Download Protein FASTA

103 aa · TkA02G185920|TK1151|PROTEIN

MEITAFLEPLVIFLILIVNAMVNVWQENNDEKALEALKEIQSDQASVIHNENCSDIGVISCWLLASSMKCLYHIHLFCTFLLSFCIIDQQFVDLRFMVRRFQL

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G185920`
TK1151 ID	TkA02G185920
OH-1004 ID	LXL04_036481
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	90.000
Protein coverage (%)	TK1151 48.544 / OH-1004 4.808 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G185920

Location Chr02:47790545-47793629 (-)

Description Similar to ECA1: Calcium-transporting ATPase 1, endoplasmic reticulum-type

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g07810`	This magnesium-dependent enzyme catalyzes the hydrolysis of ATP coupled with the translocation of calcium from the cytosol to the endoplasmic reticulum lumen.	No verified direct reference in this release
`At1g07670`	This magnesium-dependent enzyme catalyzes the hydrolysis of ATP coupled with the translocation of calcium from the cytosol to an endomembrane compartment.	No verified direct reference in this release
`At4g00900`	This magnesium-dependent enzyme catalyzes the hydrolysis of ATP coupled with the translocation of calcium from the cytosol to an endomembrane compartment.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_036481 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006816 calcium ion transport Biological Process

GO:0006874 intracellular calcium ion homeostasis Biological Process

GO:0010042 response to manganese ion Biological Process

GO:0070588 calcium ion transmembrane transport Biological Process

GO:0000325 plant-type vacuole Cellular Component

GO:0005576 extracellular region Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005783 endoplasmic reticulum Cellular Component

GO:0005789 endoplasmic reticulum membrane Cellular Component

GO:0016020 membrane Cellular Component

GO:0005388 P-type calcium transporter activity Molecular Function

GO:0005524 ATP binding Molecular Function

KEGG gene cross-reference

ath:AT1G07670

ath:AT1G07810

ath:AT4G00900

sly:543554

tgo:TGME49_230420

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.288

Rank 1 · TkA02G185920 · TK1151

Cytoplasm0.275

Rank 2 · TkA02G185920 · TK1151

Nucleus0.161

Rank 3 · TkA02G185920 · TK1151

Golgi apparatus0.150

Rank 4 · TkA02G185920 · TK1151

Mitochondrion0.143

Rank 5 · TkA02G185920 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02438Adeno_10010-85 aa

PF09716ETRAMP10-42 aa

PF25058ARM_TT2115-47 aa

PF09716ETRAMP68-87 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G185920	`PF02438`	Adeno_100	10	85	0.0072	15.3
TkA02G185920	`PF09716`	ETRAMP	10	42	1.9	9.3
TkA02G185920	`PF25058`	ARM_TT21	15	47	0.13	12.9
TkA02G185920	`PF09716`	ETRAMP	68	87	1.9	9.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`P92939`	Arabidopsis thaliana	sp\|P92939\|ECA1_ARATH Calcium-transporting ATPase 1, endoplasmic reticulum-type	76.000%	Swiss-Prot	Low
`Q9XES1`	Arabidopsis thaliana	sp\|Q9XES1\|ECA4_ARATH Calcium-transporting ATPase 4, endoplasmic reticulum-type	76.000%	Swiss-Prot	Low
`O23087`	Arabidopsis thaliana	sp\|O23087\|ECA2_ARATH Calcium-transporting ATPase 2, endoplasmic reticulum-type	64.600%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card