RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkA02G182800
Reference: TK1151 Chr: Chr02 Coordinates: 47000365-47001036 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

672 bp · TkA02G182800|TK1151|cDNA

ATGACATCTAACGGTGACCCAAAATCTTCACCACGTCTAACCGATCAAACATCATCCCTCCCAAGAAGAAGATTCCGGCGAATCAAAAGTGCCCCACTTCCCGACTCTTTTGGTCCTGAAATTAAAAACGCCACCGCATCTCCGCCACACCCCAAGTCCGCTTTCGATCTCTTTTACCTGAGTTACTGGAAGGTAGGTGTCGTCTTCTTTGCATATCTTACTGCAGGTATGATTTGCTTTCATCTAGCAGGACACCAAAT...

CDS

Download CDS FASTA

672 bp · TkA02G182800|TK1151|CDS

ATGACATCTAACGGTGACCCAAAATCTTCACCACGTCTAACCGATCAAACATCATCCCTCCCAAGAAGAAGATTCCGGCGAATCAAAAGTGCCCCACTTCCCGACTCTTTTGGTCCTGAAATTAAAAACGCCACCGCATCTCCGCCACACCCCAAGTCCGCTTTCGATCTCTTTTACCTGAGTTACTGGAAGGTAGGTGTCGTCTTCTTTGCATATCTTACTGCAGGTATGATTTGCTTTCATCTAGCAGGACACCAAAT...

Protein

Download Protein FASTA

223 aa · TkA02G182800|TK1151|PROTEIN

MTSNGDPKSSPRLTDQTSSLPRRRFRRIKSAPLPDSFGPEIKNATASPPHPKSAFDLFYLSYWKVGVVFFAYLTAGMICFHLAGHQISGKKTNSIIDALYFTIVTMTTVGYGDLVPASNLTILLACLFVVSGTLIVGLVLSKAADLLVEKQERLLVKALHMNETIGKAEILKKIKTKKVRNKCIILVIFLLVLMAAGTGIFISVEDLDFIHAFYCVTNIIPVC

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkA02G182800
TK1151 IDTkA02G182800
OH-1004 IDLXL04_016159
Relationship / confidenceMulti Source To Oh1004 / Complex relationship
Protein identity (%)97.700
Protein coverage (%)TK1151 95.964 / OH-1004 100.000
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkA02G182800
LocationChr02:47000365-47001036 (+)
DescriptionSimilar to TPK1: Two-pore potassium channel 1
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At5g55630 Voltage-independent, large conductance and potassium- selective tonoplast ion channel.
TPK1 is a vacuolar ion channel different from the slow-vacuolar cation channel.2005 · DOI: 10.1104/pp.105.065599
TPK1, a Ca(2+)-regulated Arabidopsis vacuole two-pore K(+) channel is activated by 14-3-3 proteins.2007 · DOI: 10.1111/j.1365-313x.2007.03255.x
At1g02510 Voltage-independent, instantaneously activating, potassium-selective plasma membrane ion channel. No verified direct reference in this release
At5g46370 Probable voltage-independent potassium-selective tonoplast ion channel. No verified direct reference in this release

Rice

Reference gene IDPossible functionPapers / DOI
Os03g0752300 Highly selective inward-rectifying potassium channel that is specifically located in the tonoplast of large vacuoles.
Rice two-pore K+ channels are expressed in different types of vacuoles.2011 · DOI: 10.1105/tpc.110.081463
Os07g0108800 Highly selective inward-rectifying potassium channel that is specifically located in the tonoplast of protein storage vacuoles.
Rice two-pore K+ channels are expressed in different types of vacuoles.2011 · DOI: 10.1105/tpc.110.081463
Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_016159 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)
GO:0010029 regulation of seed germination Biological Process
GO:0010119 regulation of stomatal movement Biological Process
GO:0030007 intracellular potassium ion homeostasis Biological Process
GO:0071257 cellular response to electrical stimulus Biological Process
GO:0071805 potassium ion transmembrane transport Biological Process
GO:0097623 potassium ion export across plasma membrane Biological Process
GO:1990573 potassium ion import across plasma membrane Biological Process
GO:0005634 nucleus Cellular Component
GO:0005774 vacuolar membrane Cellular Component
GO:0005886 plasma membrane Cellular Component
GO:0009705 plant-type vacuole membrane Cellular Component
GO:0031004 potassium ion-transporting ATPase complex Cellular Component
KEGG gene cross-reference
ath:AT1G02510
ath:AT5G46370
ath:AT5G55630
dosa:Os03g0752300
dosa:Os07g0108800
osa:4334137
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.738
Rank 1 · TkA02G182800 · TK1151
Cytoplasm0.133
Rank 2 · TkA02G182800 · TK1151
Endoplasmic reticulum0.083
Rank 3 · TkA02G182800 · TK1151
Lysosome / Vacuole0.070
Rank 4 · TkA02G182800 · TK1151
Mitochondrion0.049
Rank 5 · TkA02G182800 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF30508DUF862053-83 aa
PF01007IRK58-140 aa
PF00520Ion_trans66-140 aa
PF30169YbfB67-108 aa
PF07885Ion_trans_268-148 aa
PF12420DUF3671102-131 aa
PF30508DUF8620121-143 aa
PF12420DUF3671159-220 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
TkA02G182800PF30508DUF862053832.68.9
TkA02G182800PF01007IRK581400.005517.3
TkA02G182800PF00520Ion_trans661409.1e-0729.0
TkA02G182800PF30169YbfB671080.3612.0
TkA02G182800PF07885Ion_trans_2681481.1e-1661.2
TkA02G182800PF12420DUF36711021315.07.2
TkA02G182800PF30508DUF86201211432.68.9
TkA02G182800PF12420DUF36711592205.07.2
TkA02G182800PF30169YbfB1761970.3612.0
TkA02G182800PF30508DUF86201782162.68.9
TkA02G182800PF00520Ion_trans1792019.1e-0729.0
TkA02G182800PF01007IRK1791900.005517.3
TkA02G182800PF07885Ion_trans_21892171.1e-1661.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
Q8LBL1Arabidopsis thalianasp|Q8LBL1|KCO1_ARATH Two-pore potassium channel 147.600%Swiss-ProtMedium
Q9FWX6Arabidopsis thalianasp|Q9FWX6|KCO4_ARATH Two-pore potassium channel 431.300%Swiss-ProtMedium
Q9FL25Arabidopsis thalianasp|Q9FL25|KCO2_ARATH Two-pore potassium channel 228.700%Swiss-ProtLow
Q850M0Oryza sativa subsp. japonicasp|Q850M0|KCO1_ORYSJ Two pore potassium channel a43.800%Swiss-ProtMedium
Q8LIN5Oryza sativa subsp. japonicasp|Q8LIN5|KCO2_ORYSJ Two pore potassium channel b48.700%Swiss-ProtMedium

JBrowse

View in Genome Browser