LXL04_016159 | RubberDandelionOmics

Gene overview

LXL04_016159

Reference: OH-1004 Chr: Chr03 Coordinates: 112579921-112580565 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

645 bp · LXL04_016159|LXL04_016159|OH1004|cDNA

ATGACATCTAACGGTGACCCAAAATCTTCACCACGTCTAACCGATCAAACATCATCCCTCCCAAGAAGAAGATTCCGGCGAATCAAAAGTGCCCCACTTCCCGACTCTTTTGGTCCTGAAATTAAAAACGCCACCGCATCTCTGCCACACCCCAAGTCCGCTTTCGATCTCTTTTACCTGAGTTACTGGAAGGCAGGTGTCGTCTTCTTTGCATATCTTACTGCAGGTATGATTTGCTTTCATCTAGCAGGACACCAAAT...

CDS

Download CDS FASTA

645 bp · LXL04_016159|LXL04_016159|OH1004|CDS

ATGACATCTAACGGTGACCCAAAATCTTCACCACGTCTAACCGATCAAACATCATCCCTCCCAAGAAGAAGATTCCGGCGAATCAAAAGTGCCCCACTTCCCGACTCTTTTGGTCCTGAAATTAAAAACGCCACCGCATCTCTGCCACACCCCAAGTCCGCTTTCGATCTCTTTTACCTGAGTTACTGGAAGGCAGGTGTCGTCTTCTTTGCATATCTTACTGCAGGTATGATTTGCTTTCATCTAGCAGGACACCAAAT...

Protein

Download Protein FASTA

214 aa · LXL04_016159|LXL04_016159|OH1004|PROTEIN

MTSNGDPKSSPRLTDQTSSLPRRRFRRIKSAPLPDSFGPEIKNATASLPHPKSAFDLFYLSYWKAGVVFFAYLTAGMICFHLAGHQISGKKTNSILDALYFTIVTMTTVGYGDLVPASNLTILLACLFVASGTLIVGLVLSKAADLLVEKQERLLVKALHMNETIGKAEILKKIKTKKVRNKCIILVVFLLVLMAAGTGIFISVEDLDFIHAFY

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_016159`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_016159

Location Chr03:112579921-112580565 (-)

Description Similar to TPK1: Two-pore potassium channel 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g55630`	Voltage-independent, large conductance and potassium- selective tonoplast ion channel.	TPK1 is a vacuolar ion channel different from the slow-vacuolar cation channel.2005 · DOI: 10.1104/pp.105.065599 TPK1, a Ca(2+)-regulated Arabidopsis vacuole two-pore K(+) channel is activated by 14-3-3 proteins.2007 · DOI: 10.1111/j.1365-313x.2007.03255.x
`At1g02510`	Voltage-independent, instantaneously activating, potassium-selective plasma membrane ion channel.	No verified direct reference in this release
`At5g46370`	Probable voltage-independent potassium-selective tonoplast ion channel.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os03g0752300`	Highly selective inward-rectifying potassium channel that is specifically located in the tonoplast of large vacuoles.	Rice two-pore K+ channels are expressed in different types of vacuoles.2011 · DOI: 10.1105/tpc.110.081463
`Os07g0108800`	Highly selective inward-rectifying potassium channel that is specifically located in the tonoplast of protein storage vacuoles.	Rice two-pore K+ channels are expressed in different types of vacuoles.2011 · DOI: 10.1105/tpc.110.081463

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_016159 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0010029 regulation of seed germination Biological Process

GO:0010119 regulation of stomatal movement Biological Process

GO:0030007 intracellular potassium ion homeostasis Biological Process

GO:0071257 cellular response to electrical stimulus Biological Process

GO:0071805 potassium ion transmembrane transport Biological Process

GO:0097623 potassium ion export across plasma membrane Biological Process

GO:1990573 potassium ion import across plasma membrane Biological Process

GO:0005634 nucleus Cellular Component

GO:0005774 vacuolar membrane Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009705 plant-type vacuole membrane Cellular Component

GO:0031004 potassium ion-transporting ATPase complex Cellular Component

KEGG gene cross-reference

ath:AT1G02510

ath:AT5G46370

ath:AT5G55630

dosa:Os03g0752300

dosa:Os07g0108800

osa:4334137

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.632

Rank 1 · LXL04_016159 · OH-1004

Lysosome / Vacuole0.133

Rank 2 · LXL04_016159 · OH-1004

Cytoplasm0.127

Rank 3 · LXL04_016159 · OH-1004

Endoplasmic reticulum0.116

Rank 4 · LXL04_016159 · OH-1004

Golgi apparatus0.057

Rank 5 · LXL04_016159 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00520.38Ion_trans66-140 aa

PF07885.23Ion_trans_268-148 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_016159	`PF00520.38`	Ion_trans	66	140	4.7e-07	29.9
LXL04_016159	`PF07885.23`	Ion_trans_2	68	148	1.2e-15	57.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8LBL1`	Arabidopsis thaliana	Two-pore potassium channel 1	54.362%	Swiss-Prot	moderate database homology
`Q9FWX6`	Arabidopsis thaliana	Two-pore potassium channel 4	30.055%	Swiss-Prot	moderate database homology
`Q9FL25`	Arabidopsis thaliana	Two-pore potassium channel 2	27.848%	Swiss-Prot	weak database homology
`Q850M0`	Oryza sativa subsp. japonica	Two pore potassium channel a	41.262%	Swiss-Prot	moderate database homology
`Q8LIN5`	Oryza sativa subsp. japonica	Two pore potassium channel b	44.041%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card