TkA02G173580 | RubberDandelionOmics

Gene overview

TkA02G173580

Reference: TK1151 Chr: Chr02 Coordinates: 44595208-44600049 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

3931 bp · TkA02G173580|TK1151|cDNA

TTCTCCGGCGACTCACTTTTCCCCGGCCAAACTATCTTCTCCGGCAACAGCTGATGTACTCCATCCTCCAGCCCCTTTCCATACTCACTCACAATAGAACTTTTGTTCAACTCAAATTTCCCAGTCACCGGTTCCATAAGCTTTGTGTAACTCATCTGTTATTCCGGCATATACCTATACGGAATTACTTCCTTCCGACAGGAGAAATTACATCTATCATCCTCCGCCTCTCACCGGAGCCAACCAAACGAATCTCCACC...

CDS

Download CDS FASTA

1764 bp · TkA02G173580|TK1151|CDS

ATGGCGTCTTCTTCAACTTCATCTGTTCCTAAGAGCTTTAAATATGATGTATTTCTGAGTTTTAGAGGTGAAGACACTCGTACAAACTTCACTGATCATCTTTATGATGCTCTTAAGCGAAAAGGCATTTTTACATACAAGGATGATGAGGCAATCAGAAAGGGAAACTTGATCAGCGATGACCTGATCCAATCTATTGAAGACTCAAGATTCTATATCATAGTTTTCTCAAAGAACTATGCATCTTCCCGTTGGTGTTT...

Protein

Download Protein FASTA

587 aa · TkA02G173580|TK1151|PROTEIN

MASSSTSSVPKSFKYDVFLSFRGEDTRTNFTDHLYDALKRKGIFTYKDDEAIRKGNLISDDLIQSIEDSRFYIIVFSKNYASSRWCLDELVKIMECQKTTEHTAYPVFYDVEPTEVRKQIGAVGKAFAKHKRDKAARRWKEALKEAADLAGWELKKTANGHEAEFIRIIVEDISKCLPSNNYCFDEKLVGMETRVKNVISYLEMDIDDVTMIGIKGIGGGGKTTLARVVLDQISFQFEGISFVENVREISKASVYGLASL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G173580`
TK1151 ID	TkA02G173580
OH-1004 ID	LXL04_016216
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	93.500
Protein coverage (%)	TK1151 93.697 / OH-1004 49.593 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G173580

Location Chr02:44595208-44600049 (+)

Description Similar to RPV1: Disease resistance protein RPV1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g18370`	TIR-NB-LRR receptor-like protein involved in plant defense.	Matching NLR Immune Receptors to Autoimmunity in camta3 Mutants Using Antimorphic NLR Alleles.2017 · DOI: 10.1016/j.chom.2017.03.005

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_016216 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006952 defense response Biological Process

GO:0007165 signal transduction Biological Process

GO:0009626 plant-type hypersensitive response Biological Process

GO:0019677 NAD+ catabolic process Biological Process

GO:0043068 positive regulation of programmed cell death Biological Process

GO:0050832 defense response to fungus Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0003953 NAD+ nucleosidase activity Molecular Function

GO:0005524 ATP binding Molecular Function

GO:0042803 protein homodimerization activity Molecular Function

GO:0043531 ADP binding Molecular Function

KEGG gene cross-reference No functional description available

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.409

Rank 1 · TkA02G173580 · TK1151

Cytoplasm0.387

Rank 2 · TkA02G173580 · TK1151

Nucleus0.164

Rank 3 · TkA02G173580 · TK1151

Endoplasmic reticulum0.096

Rank 4 · TkA02G173580 · TK1151

Extracellular0.053

Rank 5 · TkA02G173580 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01582TIR14-177 aa

PF13676TIR_217-113 aa

PF30351GPG169-94 aa

PF30351GPG1130-167 aa

PF00931NB-ARC192-365 aa

PF01637ATPase_2198-309 aa

PF24883NPHP3_N211-237 aa

PF05729NACHT214-333 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G173580	`PF01582`	TIR	14	177	6.9e-51	173.3
TkA02G173580	`PF13676`	TIR_2	17	113	4.2e-15	57.0
TkA02G173580	`PF30351`	GPG1	69	94	0.14	12.8
TkA02G173580	`PF30351`	GPG1	130	167	0.14	12.8
TkA02G173580	`PF00931`	NB-ARC	192	365	5.8e-22	78.8
TkA02G173580	`PF01637`	ATPase_2	198	309	0.0013	19.3
TkA02G173580	`PF24883`	NPHP3_N	211	237	0.091	13.7
TkA02G173580	`PF05729`	NACHT	214	333	0.00033	21.2
TkA02G173580	`PF13401`	AAA_22	214	312	0.053	14.6
TkA02G173580	`PF00004`	AAA	216	306	0.038	15.1
TkA02G173580	`PF23282`	WHD_ROQ1	432	505	6.2e-13	49.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`F4JWM0`	Arabidopsis thaliana	sp\|F4JWM0\|DSC2_ARATH Disease resistance-like protein DSC2	36.100%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card