TkA02G168510 | RubberDandelionOmics

Gene overview

TkA02G168510

Reference: TK1151 Chr: Chr02 Coordinates: 43206840-43208932 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1849 bp · TkA02G168510|TK1151|cDNA

CTCCCGGCGCCGTTCTCCGATGGAAAAATCTGATTCAGACTCCGATGGATCTCACGTTTCGTCCACGCCTCCTCGTCAACCATATCGGCCTCCTCCCCTTCTCTCTCGGCCACCCCCACCGCCGGCACCACATACTCTTCTGTTTTCTGGTAAGCAACCAAAAGACCCCAAATCAAAAGCCAAATCCAGTTCTTCCCGGCCAATTTTGAGAATTAAACCATCCACCAGGAAAATTAAGCCACCTCCTCCGAAATCTACAC...

CDS

Download CDS FASTA

1221 bp · TkA02G168510|TK1151|CDS

ATGGAATTGATCATGGTTTGGGAGCCAAAGTTGGTGGTAGTTACAGCCAAGCCGGAGATGCTAATGTCACAGATTCGGAAAAAAATTGTGGACAATCATCCAAATTTGATTGGAAGTTGTACTTCTCGGTTGGAACATGCGAATACGTCCGATACTACACGTGTGAATGAAACCTTAGGTCGAGATGTTAATGCCAGAGATCCGGGGAAAGCTGTGAAGAAGAAGCATCCTAATGCGATTTCAAGCTGTGTTTACCCTAT...

Protein

Download Protein FASTA

406 aa · TkA02G168510|TK1151|PROTEIN

MELIMVWEPKLVVVTAKPEMLMSQIRKKIVDNHPNLIGSCTSRLEHANTSDTTRVNETLGRDVNARDPGKAVKKKHPNAISSCVYPMAQVSKPKLVNEGNFVRLNINGHGGRKKFTNKVRKRNPNAYNGSRKSYKRTKRKTKVGGEGEEDQRFCEEEGFPMEKDEETDVRLDLEVIEQAVESVRHDPSDENLIKLLKLTHGYDSFRNGQLEVIRFILAGKSSLVILPTGAGKSLCYQLPAMVLHGMTLVISPLVSLMFDQ...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G168510`
TK1151 ID	TkA02G168510
OH-1004 ID	LXL04_011662
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	93.600
Protein coverage (%)	TK1151 92.365 / OH-1004 35.450 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G168510

Location Chr02:43206840-43208932 (-)

Description Similar to RECQL5: ATP-dependent DNA helicase Q-like 5

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g27880`	3'-5' DNA helicase that may play a role in the repair of DNA.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_011662 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000723 telomere maintenance Biological Process

GO:0000724 double-strand break repair via homologous recombination Biological Process

GO:0006260 DNA replication Biological Process

GO:0006281 DNA repair Biological Process

GO:0006310 DNA recombination Biological Process

GO:0008284 positive regulation of cell population proliferation Biological Process

GO:0009432 SOS response Biological Process

GO:0042631 cellular response to water deprivation Biological Process

GO:0043473 pigmentation Biological Process

GO:0045875 negative regulation of sister chromatid cohesion Biological Process

GO:0061820 telomeric D-loop disassembly Biological Process

GO:0000781 chromosome, telomeric region Cellular Component

KEGG gene cross-reference

ath:AT1G27880

hin:HI_0728

hsa:9401

mmu:79456

pmu:PM1427

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.871

Rank 1 · TkA02G168510 · TK1151

Cytoplasm0.152

Rank 2 · TkA02G168510 · TK1151

Cell membrane0.032

Rank 3 · TkA02G168510 · TK1151

Mitochondrion0.024

Rank 4 · TkA02G168510 · TK1151

Endoplasmic reticulum0.022

Rank 5 · TkA02G168510 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF04851ResIII206-365 aa

PF00270DEAD208-372 aa

PF13401AAA_22227-331 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G168510	`PF04851`	ResIII	206	365	0.00019	22.1
TkA02G168510	`PF00270`	DEAD	208	372	1.9e-23	83.8
TkA02G168510	`PF13401`	AAA_22	227	331	0.2	12.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q0WVW7`	Arabidopsis thaliana	sp\|Q0WVW7\|RQL5_ARATH ATP-dependent DNA helicase Q-like 5	56.300%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card