Gene Card
Gene overview
cDNA / CDS / Protein Sequences
357 bp · TkA02G161840|TK1151|cDNA
ACAATTACATGGCTTGATTCTGTCACTAATGTTCCATTAAGGGCAGAAAGGTCATTCATCTGTAATGACACTGGTTCATTAATCCAAGAACCTCCAAAACGTTTCCAAACTTACAAAAATGAAGACATAAAGTTTTCAGTGGAAGAACTTTCAGAAATCAAAAAAGTTGGAATAGGAAGTTTAAGGCTTTTAGGGTTTAAGCCATTAAGTTGCTTGAAAGATTATTATAACTTAAAACCATCAACATTTGTGTTTCCTAG...
357 bp · TkA02G161840|TK1151|CDS
ACAATTACATGGCTTGATTCTGTCACTAATGTTCCATTAAGGGCAGAAAGGTCATTCATCTGTAATGACACTGGTTCATTAATCCAAGAACCTCCAAAACGTTTCCAAACTTACAAAAATGAAGACATAAAGTTTTCAGTGGAAGAACTTTCAGAAATCAAAAAAGTTGGAATAGGAAGTTTAAGGCTTTTAGGGTTTAAGCCATTAAGTTGCTTGAAAGATTATTATAACTTAAAACCATCAACATTTGTGTTTCCTAG...
Protein
Download Protein FASTA119 aa · TkA02G161840|TK1151|PROTEIN
TITWLDSVTNVPLRAERSFICNDTGSLIQEPPKRFQTYKNEDIKFSVEELSEIKKVGIGSLRLLGFKPLSCLKDYYNLKPSTFVFPSDEEVIGSTCIFIALHRSMISLKCFAVAFYGSS
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA02G161840 |
|---|---|
| TK1151 ID | TkA02G161840 |
| OH-1004 ID | LXL04_025954 |
| Relationship / confidence | Sequence Supported Annotation Or Model Conflict / Review |
| Protein identity (%) | 99.200 |
| Protein coverage (%) | TK1151 100.000 / OH-1004 19.101Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA02G161840 | ||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr02:41486290-41486791 (+) | ||||||||||||
| Description | Similar to KU70: ATP-dependent DNA helicase 2 subunit KU70 | ||||||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
Rice
| ||||||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | ||||||||||||
| GO annotations (OH1004 source) | GO:0000723 telomere maintenance Biological Process GO:0000725 recombinational repair Biological Process GO:0002218 activation of innate immune response Biological Process GO:0006281 DNA repair Biological Process GO:0006302 double-strand break repair Biological Process GO:0006303 double-strand break repair via nonhomologous end joining Biological Process GO:0006310 DNA recombination Biological Process GO:0006351 DNA-templated transcription Biological Process GO:0006974 DNA damage response Biological Process GO:0009408 response to heat Biological Process GO:0010212 response to ionizing radiation Biological Process GO:0045087 innate immune response Biological Process | ||||||||||||
| KEGG gene cross-reference | ath:AT1G16970 dosa:Os07g0184900 gga:395767 hsa:2547 mmu:14375 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF02735Ku2-116 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| TkA02G161840 | PF02735 | Ku | 2 | 116 | 8.8e-21 | 75.4 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.