TkA02G148980 | RubberDandelionOmics

Gene overview

TkA02G148980

Reference: TK1151 Chr: Chr02 Coordinates: 38412586-38416584 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2072 bp · TkA02G148980|TK1151|cDNA

CTGATCTTACGATCACGATCTTGAAACTGGCAAAACGATCTTAGGTAGGATCCGACTTTAACAAGAATTTCTTTCTCTTGATCGAAAATGGCGGACGGAGAGTGAGTTGGGGGCTGCGTCCAAGTTGCGAAAATATCCGTGAAAATGGCGGAAGGAGACACAGACTGGGAAATACATCTAAGAACATTATCTTCGAACGCCAGAGACTCCAGTTTCTCCAATGATCCCGCTTCAGATCCTTCTCTTCTTCGTTCCGTGAG...

CDS

Download CDS FASTA

1719 bp · TkA02G148980|TK1151|CDS

ATGGCGGAAGGAGACACAGACTGGGAAATACATCTAAGAACATTATCTTCGAACGCCAGAGACTCCAGTTTCTCCAATGATCCCGCTTCAGATCCTTCTCTTCTTCGTTCCGTGAGGAAGCTCACCGAATTGTGTAAAAGTGAAAACTCTGAGAATCTGATAGCTAGGGTTTATCCTCAACTCAATAAGATCTTTCAGCGTTCTGTTTCATCTATTTCTCACTCTCGATCATCTTCTGGACTCGTGCTACTGGCGATTCT...

Protein

Download Protein FASTA

572 aa · TkA02G148980|TK1151|PROTEIN

MAEGDTDWEIHLRTLSSNARDSSFSNDPASDPSLLRSVRKLTELCKSENSENLIARVYPQLNKIFQRSVSSISHSRSSSGLVLLAILQFFIDYGEFVLHDADPSLRTFFRSCLSREFADPIVAEATLDFLNINKKKISLASPTLLPQFYPLLLKMFAWNGDKLEKPFLKVFPGLIAPGSFLPLFISLVDLPVLIVALEKVEKSSGPLIGSSIASIQKSAAPEMLLALMDEAYTGSMIGDGGADSENEDNNSIISDPLFLE...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G148980`
TK1151 ID	TkA02G148980
OH-1004 ID	LXL04_016369
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	98.500
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA02G148980`
Location	Chr02:38412586-38416584 (-)
Description	Similar to AP5Z1: AP-5 complex subunit zeta-1
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_016369` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0000045 autophagosome assembly Biological Process GO:0000724 double-strand break repair via homologous recombination Biological Process GO:0006886 intracellular protein transport Biological Process GO:0006914 autophagy Biological Process GO:0007030 Golgi organization Biological Process GO:0007040 lysosome organization Biological Process GO:0010467 gene expression Biological Process GO:0015031 protein transport Biological Process GO:0016192 vesicle-mediated transport Biological Process GO:0016197 endosomal transport Biological Process GO:0034499 late endosome to Golgi transport Biological Process GO:1905146 lysosomal protein catabolic process Biological Process
KEGG gene cross-reference	hsa:9907 mmu:231855 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.672

Rank 1 · TkA02G148980 · TK1151

Cytoplasm0.271

Rank 2 · TkA02G148980 · TK1151

Cell membrane0.076

Rank 3 · TkA02G148980 · TK1151

Endoplasmic reticulum0.072

Rank 4 · TkA02G148980 · TK1151

Golgi apparatus0.053

Rank 5 · TkA02G148980 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF14764SPG4830-154 aa

PF25154TPR_AP5Z1_C167-218 aa

PF25154TPR_AP5Z1_C281-516 aa

PF14764SPG48456-492 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G148980	`PF14764`	SPG48	30	154	1.2e-35	123.1
TkA02G148980	`PF25154`	TPR_AP5Z1_C	167	218	1.9e-28	100.0
TkA02G148980	`PF25154`	TPR_AP5Z1_C	281	516	1.9e-28	100.0
TkA02G148980	`PF14764`	SPG48	456	492	1.2e-35	123.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card