TkA02G140830 | RubberDandelionOmics

Gene overview

TkA02G140830

Reference: TK1151 Chr: Chr02 Coordinates: 36366804-36371811 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2553 bp · TkA02G140830|TK1151|cDNA

GAGAAATCAAAAATGGCATCCATGGTGTCACTTTGACGAAGAAGAGACGGAATTTCTTCAAATTCCCGCCACTGCTCAACCGGTGTTGACGAATTCCATACTTCTTAAGTTCATCCAACGTTCATAAATCCTGCTTACAGGGTTCAAAGAGCTGAAACTCTCCTATGGGTGATTTATCAAGGGAGGATCACAGCAACACAGTTCGTGTACTTGTTGCCACAGATTGTCATTTGGGATATATGGAAAAAGATGAAGTTCGT...

CDS

Download CDS FASTA

2145 bp · TkA02G140830|TK1151|CDS

ATGGGTGATTTATCAAGGGAGGATCACAGCAACACAGTTCGTGTACTTGTTGCCACAGATTGTCATTTGGGATATATGGAAAAAGATGAAGTTCGTAGGCATGACTCATTTCAAGCATTTGAAGAGATATGCTCAATAGCAGAACAAAAGAAGGTGGACTTTGTACTCCTTGGTGGTGATCTTTTTCATGAAAACAAACCATCAAGAACAACATTAGTGAAAACAATAGAGATTTTGAGAAGATATTGTCTTAATGATAA...

Protein

Download Protein FASTA

714 aa · TkA02G140830|TK1151|PROTEIN

MGDLSREDHSNTVRVLVATDCHLGYMEKDEVRRHDSFQAFEEICSIAEQKKVDFVLLGGDLFHENKPSRTTLVKTIEILRRYCLNDKPVQFQVVSDQTINFANVFGHVNYEDPHFNVGLPVFSIHGNHDDPAGVDNLSAVDILSACNLVNYFGKMVLGGSGVGQITLYPILIKKGSTSVALYGLGNIRDERLNRMFQTPHAVQWMRPEAQESCQVSDWFNILVLHQNRVKTNPKNAINEHFLPRFLDFIVWGHEHECLVD...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G140830`
TK1151 ID	TkA02G140830
OH-1004 ID	LXL04_016440
Relationship / confidence	Rbh Sequence Supported / Probable
Protein identity (%)	94.600
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G140830

Location Chr02:36366804-36371811 (-)

Description Similar to MRE11: Double-strand break repair protein MRE11

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g54260`	Core component of the MRN complex, which plays a central role in double-strand break (DSB) repair, DNA recombination, maintenance of telomere integrity and meiosis.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`UniProt: Q25AA3`	Core component of the MRN complex, which plays a central role in double-strand break (DSB) repair, DNA recombination, maintenance of telomere integrity and meiosis.	No verified direct reference in this release
`Os04g0635900`	Core component of the MRN complex, which plays a central role in double-strand break (DSB) repair, DNA recombination, maintenance of telomere integrity and meiosis.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_016440 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000019 regulation of mitotic recombination Biological Process

GO:0000723 telomere maintenance Biological Process

GO:0000724 double-strand break repair via homologous recombination Biological Process

GO:0000729 DNA double-strand break processing Biological Process

GO:0006281 DNA repair Biological Process

GO:0006302 double-strand break repair Biological Process

GO:0006303 double-strand break repair via nonhomologous end joining Biological Process

GO:0006310 DNA recombination Biological Process

GO:0006974 DNA damage response Biological Process

GO:0007004 telomere maintenance via telomerase Biological Process

GO:0007062 sister chromatid cohesion Biological Process

GO:0007095 mitotic G2 DNA damage checkpoint signaling Biological Process

KEGG gene cross-reference

ath:AT5G54260

dosa:Os04g0635900

hsa:4361

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.944

Rank 1 · TkA02G140830 · TK1151

Cytoplasm0.155

Rank 2 · TkA02G140830 · TK1151

Mitochondrion0.028

Rank 3 · TkA02G140830 · TK1151

Cell membrane0.019

Rank 4 · TkA02G140830 · TK1151

Endoplasmic reticulum0.010

Rank 5 · TkA02G140830 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00149Metallophos14-257 aa

PF27086LRR_F-Box-like49-102 aa

PF04152Mre11_DNA_bind303-455 aa

PF22743PspAA331-364 aa

PF27086LRR_F-Box-like422-457 aa

PF22743PspAA443-495 aa

PF04152Mre11_DNA_bind486-515 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G140830	`PF00149`	Metallophos	14	257	4.6e-16	60.6
TkA02G140830	`PF27086`	LRR_F-Box-like	49	102	0.28	12.0
TkA02G140830	`PF04152`	Mre11_DNA_bind	303	455	1.8e-34	120.1
TkA02G140830	`PF22743`	PspAA	331	364	0.094	13.7
TkA02G140830	`PF27086`	LRR_F-Box-like	422	457	0.28	12.0
TkA02G140830	`PF22743`	PspAA	443	495	0.094	13.7
TkA02G140830	`PF04152`	Mre11_DNA_bind	486	515	1.8e-34	120.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9XGM2`	Arabidopsis thaliana	sp\|Q9XGM2\|MRE11_ARATH Double-strand break repair protein MRE11	76.000%	Swiss-Prot	High
`Q25AA3`	Oryza sativa subsp. indica	sp\|Q25AA3\|MRE11_ORYSI Double-strand break repair protein MRE11	68.000%	Swiss-Prot	High
`Q7XQR9`	Oryza sativa subsp. japonica	sp\|Q7XQR9\|MRE11_ORYSJ Double-strand break repair protein MRE11	68.000%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card