TkA02G140780 | RubberDandelionOmics

Gene overview

TkA02G140780

Reference: TK1151 Chr: Chr02 Coordinates: 36350382-36357259 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

4074 bp · TkA02G140780|TK1151|cDNA

ATCATGGTACCCCCGCCACTACCACCAACCTGAATAAATTCAAAATTTCCCTTTAAGCAACAAACAGACAAATCATATTTTCCTTTTTTCCCTAATTTTCTCAAATCCCCCAAATCAATCTAGATATCTGTCTTCTATCAGACAATTCCTTCTTTCTGCCATTAATCTTTGCATTTCTTTCTCTTGGTCCGACCATAATTCATCTAAAATTTTTTAATTCATGCTTTCAAGGCAGTAGAAATTAGTTTAAAACAAGAAAC...

CDS

Download CDS FASTA

2253 bp · TkA02G140780|TK1151|CDS

ATGTGTGCCGGTGCTCCATCTGATATGAGAGATAAATTGAATCTAAGAATGGCAAGTGAGTACAAGTTCCTTAATCAAAGCGGTTGCTTAAAAATTCACGATGTTGATGATGCTGGAAATTTCAAAAAGCTGATGGAAGCCATGGATGCCCTAAAAATCTCTTGTGTAGATCAAGAACGTATCTTCAAATTGGTTGCTTCAATTTTATGGTTAGGAAACATATCATTTGAAGTAATTGATCATGAATTTCATGTTCAAGT...

Protein

Download Protein FASTA

750 aa · TkA02G140780|TK1151|PROTEIN

MCAGAPSDMRDKLNLRMASEYKFLNQSGCLKIHDVDDAGNFKKLMEAMDALKISCVDQERIFKLVASILWLGNISFEVIDHEFHVQVVPDEACRSAAKLMGCKVKDLMAVLSTNKNQQQAINMRDALVKFIYTSMFSWLVETINKSLKGESGRSISLLDIYGFESFQKNSFEQLFINYANERLHQHFVRHIFKLEQEEYESEGIEWKKVEFVDNQGCLDLFEKKEVGILSLLDEASDRLEGSDLTFFNNMKKHLSCGLRF...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G140780`
TK1151 ID	TkA02G140780
OH-1004 ID	LXL04_016442
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	98.400
Protein coverage (%)	TK1151 100.000 / OH-1004 67.294 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G140780

Location Chr02:36350382-36357259 (+)

Description Similar to VIII-2: Myosin-2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g54280`	Myosin heavy chain that is required for the cell cycle-regulated transport of various organelles and proteins for their segregation.	No verified direct reference in this release
`At4g27370`	Myosin heavy chain that is required for the cell cycle-regulated transport of various organelles and proteins for their segregation.	No verified direct reference in this release
`At3g19960`	Myosin heavy chain that is required for the cell cycle-regulated transport of various organelles and proteins for their segregation.	No verified direct reference in this release
`At1g50360`	Myosin heavy chain that is required for the cell cycle-regulated transport of various organelles and proteins for their segregation.	No verified direct reference in this release
`At1g17580`	Myosin heavy chain that is required for the cell cycle- regulated transport of various organelles and proteins for their segregation.	Enzymatic activity and motility of recombinant Arabidopsis myosin XI, MYA1.2007 · DOI: 10.1093/pcp/pcm054 A comparative study of the involvement of 17 Arabidopsis myosin family members on the motility of Golgi and other organelles.2009 · DOI: 10.1104/pp.109.136853 Myosin XIK is a major player in cytoplasm dynamics and is regulated by two amino acids in its tail.2012 · DOI: 10.1093/jxb/err265

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_016442 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006897 endocytosis Biological Process

GO:0007015 actin filament organization Biological Process

GO:0009791 post-embryonic development Biological Process

GO:0009826 unidimensional cell growth Biological Process

GO:0010082 regulation of root meristem growth Biological Process

GO:0010090 trichome morphogenesis Biological Process

GO:0010154 fruit development Biological Process

GO:0030048 actin filament-based movement Biological Process

GO:0048467 gynoecium development Biological Process

GO:0051301 cell division Biological Process

GO:0051645 Golgi localization Biological Process

GO:0051646 mitochondrion localization Biological Process

KEGG gene cross-reference

ath:AT1G17580

ath:AT1G50360

ath:AT3G19960

ath:AT4G27370

ath:AT5G54280

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.651

Rank 1 · TkA02G140780 · TK1151

Nucleus0.234

Rank 2 · TkA02G140780 · TK1151

Cell membrane0.103

Rank 3 · TkA02G140780 · TK1151

Golgi apparatus0.050

Rank 4 · TkA02G140780 · TK1151

Lysosome / Vacuole0.044

Rank 5 · TkA02G140780 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00063Myosin_head1-433 aa

PF06367Drf_FH339-53 aa

PF05377FlaC_arch155-171 aa

PF07926TPR_MLP1_2346-362 aa

PF00612IQ476-491 aa

PF00612IQ512-530 aa

PF27944CEP162_coil_mid551-572 aa

PF05377FlaC_arch564-594 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G140780	`PF00063`	Myosin_head	1	433	8.5e-113	378.6
TkA02G140780	`PF06367`	Drf_FH3	39	53	3.3	8.2
TkA02G140780	`PF05377`	FlaC_arch	155	171	5.1	8.3
TkA02G140780	`PF07926`	TPR_MLP1_2	346	362	0.031	15.0
TkA02G140780	`PF00612`	IQ	476	491	6.7e-09	35.5
TkA02G140780	`PF00612`	IQ	512	530	6.7e-09	35.5
TkA02G140780	`PF27944`	CEP162_coil_mid	551	572	1.7	9.3
TkA02G140780	`PF05377`	FlaC_arch	564	594	5.1	8.3
TkA02G140780	`PF09787`	Golgin_A5	572	630	6.7	6.9
TkA02G140780	`PF06428`	Sec2p	575	630	0.74	10.7
TkA02G140780	`PF07926`	TPR_MLP1_2	576	630	0.031	15.0
TkA02G140780	`PF13373`	Dsc3_C	577	620	0.13	13.1
TkA02G140780	`PF14362`	DUF4407	579	701	1.5	8.7
TkA02G140780	`PF06367`	Drf_FH3	579	630	3.3	8.2
TkA02G140780	`PF27944`	CEP162_coil_mid	586	628	1.7	9.3
TkA02G140780	`PF26583`	Spectrin_YLPM1	587	626	0.0054	17.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`F4K0A6`	Arabidopsis thaliana	sp\|F4K0A6\|MYO2_ARATH Myosin-2	46.600%	Swiss-Prot	Medium
`F4JIU4`	Arabidopsis thaliana	sp\|F4JIU4\|MYO4_ARATH Myosin-4	45.500%	Swiss-Prot	Medium
`Q9LHE9`	Arabidopsis thaliana	sp\|Q9LHE9\|MYO1_ARATH Myosin-1	42.900%	Swiss-Prot	Medium
`F4I507`	Arabidopsis thaliana	sp\|F4I507\|MYO3_ARATH Myosin-3	41.800%	Swiss-Prot	Medium
`Q39160`	Arabidopsis thaliana	sp\|Q39160\|MYO5_ARATH Myosin-5	37.600%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card