Gene Card
Gene overview
cDNA / CDS / Protein Sequences
5254 bp · TkA02G123770|TK1151|cDNA
CGCCCCTGCCTCTCTTTTTTTCCTTTACATGACTCAGTGAGACACAATAGATATACATAGAGAGAGAAATCGATGCATACAGAGAGGGCTAAAACCTAATCGACGTCAATCGGAGACCTGAAGGCTCGTGGGAATCGAATCAGAAGGTTAATCGACGGTTTCTAGGGTTTCATTTTTTGTTTCGTCGTCAATCTGATCAAATCGAGCAGGTTTGCAGGTAAGTGACTGTGTTTATTTTTATTGAGCTCTCACAGACTGAA...
4656 bp · TkA02G123770|TK1151|CDS
ATGCGATTATCTCCGACTACTACTCCGTCTAAGAACGAGAAAGTGATTAGGGCTAAAAGGAAACACAAGAAGCTTGATGCGATATGTGAAAAGGAGTATACTGAGAACCGTGATAAGATAGAATATCCTGAAACGAATGAGGCCAATGTTGATGCATCGGAGGTTAGGCGGAGTTCCAGGGTGAGTCGACCTCCGTTGATTTTAGATGCGTCGCCTTCTCCTGCTAAAAAGCGGAAGAGAAGTGAACGAAATGGGGAGGG...
Protein
Download Protein FASTA1551 aa · TkA02G123770|TK1151|PROTEIN
MRLSPTTTPSKNEKVIRAKRKHKKLDAICEKEYTENRDKIEYPETNEANVDASEVRRSSRVSRPPLILDASPSPAKKRKRSERNGEGSSRRGGNRDRVSLKTDLPSSTTLGLDEDDSGEWKSRLRARRRKVTFMNGDSSPRSKKKLFNHSDGVNEHSDLLNSQLDDNKGGLVGETLMVVQPKRPGRVKASNVVTNGREEENTTVFDVVKDNNNVCCSTDNVPAIELHEQGDEVEVPVTSDSKDNANNKVQSPEQSKPLEQ...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA02G123770 |
|---|---|
| TK1151 ID | TkA02G123770 |
| OH-1004 ID | LXL04_016561 |
| Relationship / confidence | Rbh High Identity Coverage Synteny / Strict |
| Protein identity (%) | 97.700 |
| Protein coverage (%) | TK1151 98.904 / OH-1004 92.840Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA02G123770 |
|---|---|
| Location | Chr02:32087010-32092624 (-) |
| Description | Similar to Atad2: ATPase family AAA domain-containing protein 2 |
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene ArabidopsisNo hit for this species in the current source table. RiceNo hit for this species in the current source table. |
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · |
| GO annotations (OH1004 source) | GO:0000122 negative regulation of transcription by RNA polymerase II Biological Process GO:0006261 DNA-templated DNA replication Biological Process GO:0006325 chromatin organization Biological Process GO:0006334 nucleosome assembly Biological Process GO:0006337 nucleosome disassembly Biological Process GO:0006338 chromatin remodeling Biological Process GO:0034080 CENP-A containing chromatin assembly Biological Process GO:0045815 transcription initiation-coupled chromatin remodeling Biological Process GO:0045893 positive regulation of DNA-templated transcription Biological Process GO:0045944 positive regulation of transcription by RNA polymerase II Biological Process GO:0000775 chromosome, centromeric region Cellular Component GO:0000785 chromatin Cellular Component |
| KEGG gene cross-reference | hsa:29028 mmu:70472 pon:100174282 sce:YGR270W These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF13832zf-HC5HC2H_2389-462 aaPF13771zf-HC5HC2H392-471 aaPF23004PHDvar_NSD438-471 aaPF13191AAA_16597-708 aaPF25199nSTAND_NTPase5597-675 aaPF13245AAA_19599-630 aaPF07728AAA_5599-678 aaPF00004AAA600-735 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| TkA02G123770 | PF13832 | zf-HC5HC2H_2 | 389 | 462 | 3.2e-07 | 31.2 |
| TkA02G123770 | PF13771 | zf-HC5HC2H | 392 | 471 | 3.6e-10 | 40.6 |
| TkA02G123770 | PF23004 | PHDvar_NSD | 438 | 471 | 0.65 | 10.8 |
| TkA02G123770 | PF13191 | AAA_16 | 597 | 708 | 2.8e-07 | 31.9 |
| TkA02G123770 | PF25199 | nSTAND_NTPase5 | 597 | 675 | 0.23 | 12.0 |
| TkA02G123770 | PF13245 | AAA_19 | 599 | 630 | 0.003 | 18.5 |
| TkA02G123770 | PF07728 | AAA_5 | 599 | 678 | 0.064 | 14.0 |
| TkA02G123770 | PF00004 | AAA | 600 | 735 | 1.5e-41 | 142.6 |
| TkA02G123770 | PF24883 | NPHP3_N | 600 | 696 | 7.7e-05 | 23.7 |
| TkA02G123770 | PF20720 | nSTAND3 | 600 | 679 | 0.002 | 18.6 |
| TkA02G123770 | PF13604 | AAA_30 | 600 | 644 | 0.16 | 12.4 |
| TkA02G123770 | PF13401 | AAA_22 | 600 | 624 | 0.22 | 12.5 |
| TkA02G123770 | PF13671 | AAA_33 | 600 | 622 | 0.25 | 12.4 |
| TkA02G123770 | PF07724 | AAA_2 | 653 | 698 | 0.043 | 14.6 |
| TkA02G123770 | PF17862 | AAA_lid_3 | 763 | 791 | 1.8e-06 | 28.1 |
| TkA02G123770 | PF13245 | AAA_19 | 967 | 1009 | 0.003 | 18.5 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.
No result was found for this query.