TkA02G105560 | RubberDandelionOmics

Gene overview

TkA02G105560

Reference: TK1151 Chr: Chr02 Coordinates: 27643911-27644920 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

725 bp · TkA02G105560|TK1151|cDNA

CTCCATTTTTGATCGTTGAAAGCAAGAGTTTCTTTGCAATTCCAAAGTCTATACTTTCTTCCCAAAGCCAATTACAATTCAAAAGTATTTCATTTGACTTCCATTTGAGTCATGGAAAAAAACCGTTCGAGTTTTCCGATGTTAGCATCAGTCTCCATACATTTGTTGGTGATATCAATCGTGGGCCTTGTTCTATATTGGCTCACAAGCTTAAGGGAAGGCCTTGCTCTCTCATCTTCCATACCAATGAAGATTTTTAA...

CDS

Download CDS FASTA

510 bp · TkA02G105560|TK1151|CDS

ATGGAAAAAAACCGTTCGAGTTTTCCGATGTTAGCATCAGTCTCCATACATTTGTTGGTGATATCAATCGTGGGCCTTGTTCTATATTGGCTCACAAGCTTAAGGGAAGGCCTTGCTCTCTCATCTTCCATACCAATGAAGATTTTTAACTTGCACCCACTTCTTATGGTACTCGGATTCTTTATTTTTTCAGGCGAAGCGATGATTGCATACAAGGCGATCCCAGCACAGAGACAAACAATTAAATTAATTCACCTTAT...

Protein

Download Protein FASTA

169 aa · TkA02G105560|TK1151|PROTEIN

MEKNRSSFPMLASVSIHLLVISIVGLVLYWLTSLREGLALSSSIPMKIFNLHPLLMVLGFFIFSGEAMIAYKAIPAQRQTIKLIHLMFHLIALASGIFGVYAVFKFHDEVKGAHMYTLHSWIGMATIVLFGFQVDIRIYYFFVPGAAPATRARFAPWHVFAGVLIFFWR

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G105560`
TK1151 ID	TkA02G105560
OH-1004 ID	LXL04_011091
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	94.600
Protein coverage (%)	TK1151 98.817 / OH-1004 75.909 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G105560

Location Chr02:27643911-27644920 (+)

Description Similar to Os02g0642300: Probable ascorbate-specific transmembrane electron transporter 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g25570`	Two-heme-containing cytochrome.	Localization of an ascorbate-reducible cytochrome b561 in the plant tonoplast.2004 · DOI: 10.1104/pp.103.032359

Rice

Reference gene ID	Possible function	Papers / DOI
`Os04g0533500`	Two-heme-containing cytochrome.	No verified direct reference in this release
`Os02g0642300`	Two-heme-containing cytochrome.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_011091 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0019852 L-ascorbic acid metabolic process Biological Process

GO:0005739 mitochondrion Cellular Component

GO:0005794 Golgi apparatus Cellular Component

GO:0016020 membrane Cellular Component

GO:0000293 ferric-chelate reductase activity Molecular Function

GO:0016491 oxidoreductase activity Molecular Function

GO:0046872 metal ion binding Molecular Function

GO:0140571 transmembrane ascorbate ferrireductase activity Molecular Function

KEGG gene cross-reference

ath:AT1G14730

ath:AT5G38630

dosa:Os02g0642300

zma:100273009

zma:100384594

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.260

Rank 1 · TkA02G105560 · TK1151

Cytoplasm0.235

Rank 2 · TkA02G105560 · TK1151

Endoplasmic reticulum0.234

Rank 3 · TkA02G105560 · TK1151

Lysosome / Vacuole0.214

Rank 4 · TkA02G105560 · TK1151

Golgi apparatus0.196

Rank 5 · TkA02G105560 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF28887PilO_N4-33 aa

PF03188Cytochrom_B56118-36 aa

PF29123R07B1_N19-33 aa

PF28759NDUFA319-27 aa

PF28759NDUFA346-74 aa

PF03188Cytochrom_B56151-167 aa

PF28887PilO_N54-80 aa

PF28887PilO_N86-105 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G105560	`PF28887`	PilO_N	4	33	1.4	9.6
TkA02G105560	`PF03188`	Cytochrom_B561	18	36	4.5e-34	118.4
TkA02G105560	`PF29123`	R07B1_N	19	33	0.015	16.1
TkA02G105560	`PF28759`	NDUFA3	19	27	7.5	7.1
TkA02G105560	`PF28759`	NDUFA3	46	74	7.5	7.1
TkA02G105560	`PF03188`	Cytochrom_B561	51	167	4.5e-34	118.4
TkA02G105560	`PF28887`	PilO_N	54	80	1.4	9.6
TkA02G105560	`PF28887`	PilO_N	86	105	1.4	9.6
TkA02G105560	`PF28759`	NDUFA3	86	108	7.5	7.1
TkA02G105560	`PF29123`	R07B1_N	87	134	0.015	16.1
TkA02G105560	`PF28759`	NDUFA3	121	134	7.5	7.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8L856`	Arabidopsis thaliana	sp\|Q8L856\|ACFR1_ARATH Transmembrane ascorbate ferrireductase 1	44.700%	Swiss-Prot	Medium
`Q7XMK3`	Oryza sativa subsp. japonica	sp\|Q7XMK3\|ACET2_ORYSJ Probable ascorbate-specific transmembrane electron transporter 2	43.700%	Swiss-Prot	Medium
`A3A9H6`	Oryza sativa subsp. japonica	sp\|A3A9H6\|ACET1_ORYSJ Probable ascorbate-specific transmembrane electron transporter 1	41.700%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card