Gene Card
Gene overview
cDNA / CDS / Protein Sequences
1287 bp · TkA02G105520|TK1151|cDNA
ATGAAGCCTTTTTTGGGAGAGTTGTATGAGTCCCCTGCTCAGTTGAGGTTTGCATTAACTAATTATGCTGTATCTAATGGTTACCAACTATGCTTTATGAAATCTGATAAATCCAGATTACTTGTTCGATGTGGTAAACCAAGTGATAAAAGGCAATGTCCTTTTAGGATTTATGCATCATGGAAATACAATGAGCATACATTTCAGATTAAGACCATGGTTGACACTCATCTTTGTGCAAGGAACTATAAATTTGGAAA...
1287 bp · TkA02G105520|TK1151|CDS
ATGAAGCCTTTTTTGGGAGAGTTGTATGAGTCCCCTGCTCAGTTGAGGTTTGCATTAACTAATTATGCTGTATCTAATGGTTACCAACTATGCTTTATGAAATCTGATAAATCCAGATTACTTGTTCGATGTGGTAAACCAAGTGATAAAAGGCAATGTCCTTTTAGGATTTATGCATCATGGAAATACAATGAGCATACATTTCAGATTAAGACCATGGTTGACACTCATCTTTGTGCAAGGAACTATAAATTTGGAAA...
Protein
Download Protein FASTA428 aa · TkA02G105520|TK1151|PROTEIN
MKPFLGELYESPAQLRFALTNYAVSNGYQLCFMKSDKSRLLVRCGKPSDKRQCPFRIYASWKYNEHTFQIKTMVDTHLCARNYKFGNLVSCEWLAKHYVKDIIRKPMFSSTDMKEDALRKFSIEVSKSQCYRAKVRAREMIEGKLHEHYARVWDYANELLISNPGSTCKVGVATNPDHMGAATSSWRTKVCPAIIQKIGEFGKNMRYWRVIPSRGTVFETKYAYAAYKVDLEHRYCTCRLWEISGVLCVHAQAAIKFVHL...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA02G105520 |
|---|---|
| TK1151 ID | TkA02G105520 |
| OH-1004 ID | LXL04_019412 |
| Relationship / confidence | Multi Source To Oh1004 / Complex relationship |
| Protein identity (%) | 59.400 |
| Protein coverage (%) | TK1151 95.093 / OH-1004 59.082Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA02G105520 |
|---|---|
| Location | Chr02:27631807-27633920 (-) |
| Description | Similar to Os02g0491600: Putative germin-like protein 2-1 |
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene ArabidopsisNo hit for this species in the current source table. RiceNo hit for this species in the current source table. |
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · |
| GO annotations (OH1004 source) | GO:0048046 apoplast Cellular Component GO:0030145 manganese ion binding Molecular Function |
| KEGG gene cross-reference | dosa:Os02g0491600 dosa:Os02g0491700 dosa:Os02g0491800 dosa:Os08g0189100 dosa:Os08g0189850 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF03108DBD_Tnp_Mut5-70 aaPF08731AFT20-49 aaPF22540RET_CRD34-60 aaPF08731AFT49-77 aaPF03108DBD_Tnp_Mut116-125 aaPF22540RET_CRD152-193 aaPF17281DUF5346220-282 aaPF04434SWIM227-254 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| TkA02G105520 | PF03108 | DBD_Tnp_Mut | 5 | 70 | 6.2e-10 | 39.3 |
| TkA02G105520 | PF08731 | AFT | 20 | 49 | 1.1 | 10.4 |
| TkA02G105520 | PF22540 | RET_CRD | 34 | 60 | 0.94 | 10.5 |
| TkA02G105520 | PF08731 | AFT | 49 | 77 | 1.1 | 10.4 |
| TkA02G105520 | PF03108 | DBD_Tnp_Mut | 116 | 125 | 6.2e-10 | 39.3 |
| TkA02G105520 | PF22540 | RET_CRD | 152 | 193 | 0.94 | 10.5 |
| TkA02G105520 | PF17281 | DUF5346 | 220 | 282 | 0.11 | 13.4 |
| TkA02G105520 | PF04434 | SWIM | 227 | 254 | 2e-06 | 27.9 |
| TkA02G105520 | PF08731 | AFT | 313 | 341 | 1.1 | 10.4 |
| TkA02G105520 | PF22540 | RET_CRD | 333 | 359 | 0.94 | 10.5 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.
No result was found for this query.