TkA02G096720 | RubberDandelionOmics

Gene overview

TkA02G096720

Reference: TK1151 Chr: Chr02 Coordinates: 25326596-25328158 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1329 bp · TkA02G096720|TK1151|cDNA

AAACCTGATTATAAAATGACTACAACTACCCCCCACCTGCCATTGACAATTGACTCAAAACCATCTTCTTCTTCGCACAACTCGCACAACTCCACAACTCAATTCTAAAACACTCAAGAATCTTCATTCATCGAATCCAAATCACTCAACCCCAAATTGAAACCACTCAGCAATTTTCATCTTCACACAACACCATACCTTCAATGGCCGCTTCTTCATCTTCATCTTCAACGGTTGAACAGAAGAGCTTCAAATTCGAT...

CDS

Download CDS FASTA

627 bp · TkA02G096720|TK1151|CDS

ATGATGTTTGGAAGAGCTTGTAAAGATCATGGAGTGTCACAAGACGTAAGAAACATATTGCTTTACCCTATTTTCTATGATGTCGAACCCACAGAAGTCCGTTACCAAACAGGGGTAGTTGGAGAAGCCTTTTCCAAACACGAAAATAATGAGGCTGCGGGAAAATGGAGAAATGCACTGAAAGAAGCAGCGGATCTGGCTGGGTGGGAGTTAAAGAACACATCAAATGGGAGCGAAGCCATGCTCATTCAGAAAATCAT...

Protein

Download Protein FASTA

208 aa · TkA02G096720|TK1151|PROTEIN

MMFGRACKDHGVSQDVRNILLYPIFYDVEPTEVRYQTGVVGEAFSKHENNEAAGKWRNALKEAADLAGWELKNTSNGSEAMLIQKIIEDISLELYNISFRFDEKLAGMETRVNDIVSSLKIGIDDVHMIGIKGMGGTGRQLWLDLFLIKYQFDSKVKASLGIQEPIFNLSLSLSPTNNATFLFHGVYGVRIQEPIFKIWILCLVLWSR

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G096720`
TK1151 ID	TkA02G096720
OH-1004 ID	LXL04_016943
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	83.100
Protein coverage (%)	TK1151 56.731 / OH-1004 10.886 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G096720

Location Chr02:25326596-25328158 (+)

Description Similar to RPV1: Disease resistance protein RPV1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g16950`	TIR-NB-LRR receptor-like protein that confers resistance to the pathogen Hyaloperonospora arabidopsis isolate Noco2 (downy mildew disease).	No verified direct reference in this release
`At3g44480`	TIR-NB-LRR receptor-like protein that confers resistance to the pathogen Hyaloperonospora arabidopsis (By similarity).	No verified direct reference in this release
`At4g16990`	TIR-NB-LRR receptor-like protein that confers resistance to the pathogens Leptosphaeria maculans (blackleg disease), Botrytis cinerea, Alternaria brassicicola and Alternaria brassicae.	RLM3, a TIR domain encoding gene involved in broad-range immunity of Arabidopsis to necrotrophic fungal pathogens.2008 · DOI: 10.1111/j.1365-313x.2008.03503.x
`At1g72930`	Disease resistance protein.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_016943 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0007165 signal transduction Biological Process

GO:0019677 NAD+ catabolic process Biological Process

GO:0043068 positive regulation of programmed cell death Biological Process

GO:0050832 defense response to fungus Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0003953 NAD+ nucleosidase activity Molecular Function

GO:0042803 protein homodimerization activity Molecular Function

GO:0043531 ADP binding Molecular Function

GO:0050135 NADP+ nucleosidase activity Molecular Function

GO:0061809 NAD+ nucleosidase activity, cyclic ADP-ribose generating Molecular Function

KEGG gene cross-reference No functional description available

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.315

Rank 1 · TkA02G096720 · TK1151

Endoplasmic reticulum0.228

Rank 2 · TkA02G096720 · TK1151

Nucleus0.152

Rank 3 · TkA02G096720 · TK1151

Cell membrane0.134

Rank 4 · TkA02G096720 · TK1151

Lysosome / Vacuole0.105

Rank 5 · TkA02G096720 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01582TIR17-94 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G096720	`PF01582`	TIR	17	94	7.6e-13	49.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`F4JNB7`	Arabidopsis thaliana	sp\|F4JNB7\|RPP5_ARATH Disease resistance protein RPP5	35.400%	Swiss-Prot	Medium
`F4J339`	Arabidopsis thaliana	sp\|F4J339\|RPP1_ARATH Probable disease resistance protein RPP1	36.800%	Swiss-Prot	Medium
`Q9FT77`	Arabidopsis thaliana	sp\|Q9FT77\|RLM3_ARATH Disease resistance protein RLM3	37.900%	Swiss-Prot	Medium
`Q9SSN3`	Arabidopsis thaliana	sp\|Q9SSN3\|TIR_ARATH Toll/interleukin-1 receptor-like protein	52.100%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card