LXL04_016943 | RubberDandelionOmics

Gene overview

LXL04_016943

Reference: OH-1004 Chr: Chr03 Coordinates: 137370224-137373949 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

3406 bp · LXL04_016943|LXL04_016943|OH1004|cDNA

ATGGCggcttcatcatcttcatcttcatccaTTCACAAGAGCTTCAAATACGATGTATTTTTGAGTTTTAGAGGTTCAGACACTCGTAAGAACTTCATCGGTCATCTTTATCAGGCTCTTAAGGAGAAAGGCGTTTACACTTACAAGGACGACGAGAGAATCACAAAAGGGAAAAGGATCAGTGATGACCTCCTCCGATCTATTGAAGATTCACAATTTTACATTGTGGTTTTCTCAAAGAACTATGCTTCTTCATCATG...

CDS

Download CDS FASTA

3255 bp · LXL04_016943|LXL04_016943|OH1004|CDS

ATGGCGGCTTCATCATCTTCATCTTCATCCATTCACAAGAGCTTCAAATACGATGTATTTTTGAGTTTTAGAGGTTCAGACACTCGTAAGAACTTCATCGGTCATCTTTATCAGGCTCTTAAGGAGAAAGGCGTTTACACTTACAAGGACGACGAGAGAATCACAAAAGGGAAAAGGATCAGTGATGACCTCCTCCGATCTATTGAAGATTCACAATTTTACATTGTGGTTTTCTCAAAGAACTATGCTTCTTCATCATG...

Protein

Download Protein FASTA

1084 aa · LXL04_016943|LXL04_016943|OH1004|PROTEIN

MAASSSSSSSIHKSFKYDVFLSFRGSDTRKNFIGHLYQALKEKGVYTYKDDERITKGKRISDDLLRSIEDSQFYIVVFSKNYASSSWCLDELVKIMECHKSTKHTAYPVFYDVEPTEVRYQTGVVGEAFSKHENHEAAGKWRNALKEAADLAGWELKNTADGSEAKFIKKIIENITLELYNINFSFDKKLVGIENRVDDIVSSLEIGIDDVRMIGIKGMGGAGKTTLARSVFDKISIRFEGKSFVENIREVTNNPLSGLK...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_016943`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_016943

Location Chr03:137370224-137373949 (+)

Description Similar to RPV1: Disease resistance protein RPV1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g16890`	Disease resistance protein of the TIR-NB-LRR-type.	A gain-of-function mutation in a plant disease resistance gene leads to constitutive activation of downstream signal transduction pathways in suppressor of npr1-1, constitutive 1.2003 · DOI: 10.1105/tpc.015842 Arabidopsis resistance protein SNC1 activates immune responses through association with a transcriptional corepressor.2010 · DOI: 10.1073/pnas.1002828107 Abscisic acid deficiency antagonizes high-temperature inhibition of disease resistance through enhancing nuclear accumulation of resistance proteins SNC1 and RPS4 in Arabidopsis.2012 · DOI: 10.1105/tpc.112.096198

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_016943 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0007165 signal transduction Biological Process

GO:0019677 NAD+ catabolic process Biological Process

GO:0043068 positive regulation of programmed cell death Biological Process

GO:0050832 defense response to fungus Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0003953 NAD+ nucleosidase activity Molecular Function

GO:0042803 protein homodimerization activity Molecular Function

GO:0043531 ADP binding Molecular Function

GO:0050135 NADP+ nucleosidase activity Molecular Function

GO:0061809 NAD+ nucleosidase activity, cyclic ADP-ribose generating Molecular Function

KEGG gene cross-reference No functional description available

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.391

Rank 1 · LXL04_016943 · OH-1004

Cell membrane0.272

Rank 2 · LXL04_016943 · OH-1004

Nucleus0.219

Rank 3 · LXL04_016943 · OH-1004

Endoplasmic reticulum0.120

Rank 4 · LXL04_016943 · OH-1004

Extracellular0.069

Rank 5 · LXL04_016943 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01582.26TIR16-179 aa

PF13676.12TIR_219-115 aa

PF00931.29NB-ARC194-365 aa

PF23282.2WHD_ROQ1433-502 aa

PF13855.13LRR_8651-709 aa

PF23598.2LRR_14653-734 aa

PF23598.2LRR_14720-802 aa

PF13855.13LRR_8722-780 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_016943	`PF01582.26`	TIR	16	179	2.2e-50	171.6
LXL04_016943	`PF13676.12`	TIR_2	19	115	2.3e-14	54.7
LXL04_016943	`PF00931.29`	NB-ARC	194	365	6.4e-21	75.4
LXL04_016943	`PF23282.2`	WHD_ROQ1	433	502	2.1e-17	63.7
LXL04_016943	`PF13855.13`	LRR_8	651	709	2.6e-32	111.1
LXL04_016943	`PF23598.2`	LRR_14	653	734	1.2e-54	186.2
LXL04_016943	`PF23598.2`	LRR_14	720	802	1.2e-54	186.2
LXL04_016943	`PF13855.13`	LRR_8	722	780	2.6e-32	111.1
LXL04_016943	`PF13855.13`	LRR_8	769	826	2.6e-32	111.1
LXL04_016943	`PF23598.2`	LRR_14	782	841	1.2e-54	186.2
LXL04_016943	`PF23598.2`	LRR_14	809	895	1.2e-54	186.2
LXL04_016943	`PF23598.2`	LRR_14	876	918	1.2e-54	186.2
LXL04_016943	`PF23598.2`	LRR_14	905	965	1.2e-54	186.2
LXL04_016943	`PF23598.2`	LRR_14	952	1032	1.2e-54	186.2
LXL04_016943	`PF13855.13`	LRR_8	982	1036	2.6e-32	111.1
LXL04_016943	`PF23598.2`	LRR_14	1002	1051	1.2e-54	186.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O23530`	Arabidopsis thaliana	Protein SUPPRESSOR OF npr1-1, CONSTITUTIVE 1	31.697%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card