TkA02G094280 | RubberDandelionOmics

Gene overview

TkA02G094280

Reference: TK1151 Chr: Chr02 Coordinates: 24595369-24599462 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1210 bp · TkA02G094280|TK1151|cDNA

ATAACGAGCCCCTTAGATTCCCATAATTATTGTTTCTTATCCGTGTTTGTTCTAAAACTGAAAGCTAAAAGGACACAATCTACATTCTAGGGTTCCAACGCTTTTTAAGGTACGATCATCGTCTGCAGATCTTATGATTCACTAATCGTATTCACAGTTAAAGCCGAGGAGATACCGTGTTTAATATATAATCTATTGGAGGAGATATGGCTCGAGATAGGGAATTATCTCGGTCGCCGTCGTATAAAAGGCGGAGGCAT...

CDS

Download CDS FASTA

819 bp · TkA02G094280|TK1151|CDS

ATGGCTCGAGATAGGGAATTATCTCGGTCGCCGTCGTATAAAAGGCGGAGGCATTCAAGGTCACCTTCGCCGGTGGTACACAGGAATAGTAGCCGAAGATACAGAAGCCGAAGAGATAGAAGCAGCAGATCTCCTTATTCTCATAGCAGACAAACATTCCTCATATATTTTCTTGTTTTTTATAGAAGGAGAAGTCGTTCACCAACTCCAAGGAGACATAAGAGACAAAAAAGTAGGAGTACCTCATTGTCTCCTATACC...

Protein

Download Protein FASTA

272 aa · TkA02G094280|TK1151|PROTEIN

MARDRELSRSPSYKRRRHSRSPSPVVHRNSSRRYRSRRDRSSRSPYSHSRQTFLIYFLVFYRRRSRSPTPRRHKRQKSRSTSLSPIPKSPKIVTEKTKIEEEEQKKSIFIRRQREAELKLLEEETARRVEEAIRKKVEERLSCEEIKMEIKKRVEEGRKKVVRDVAQQLEKEKEAAVIEAKRKEEQARKEKEELERLVEENRKRVEEAQRREAMEQQRREEERYRELEQLQRQNEEALLRKKQQEEEERAKQQKLLGKNK...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G094280`
TK1151 ID	TkA02G094280
OH-1004 ID	LXL04_016904
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	82.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA02G094280`
Location	Chr02:24595369-24599462 (-)
Description	Similar to At1g10890: Uncharacterized protein At1g10890
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_016904` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0000381 regulation of alternative mRNA splicing, via spliceosome Biological Process GO:0006397 mRNA processing Biological Process GO:0008380 RNA splicing Biological Process GO:0005634 nucleus Cellular Component GO:0005654 nucleoplasm Cellular Component GO:0005694 chromosome Cellular Component GO:0005739 mitochondrion Cellular Component GO:0005886 plasma membrane Cellular Component GO:0016607 nuclear speck Cellular Component GO:0003713 transcription coactivator activity Molecular Function GO:0036002 pre-mRNA binding Molecular Function GO:1990446 U1 snRNP binding Molecular Function
KEGG gene cross-reference	ath:AT1G10890 dme:Dmel_CG31712 dre:393131 dre:406834 rno:290912 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.917

Rank 1 · TkA02G094280 · TK1151

Cytoplasm0.165

Rank 2 · TkA02G094280 · TK1151

Cell membrane0.026

Rank 3 · TkA02G094280 · TK1151

Mitochondrion0.019

Rank 4 · TkA02G094280 · TK1151

Endoplasmic reticulum0.007

Rank 5 · TkA02G094280 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF15346ARGLU90-106 aa

PF13685Fe-ADH_2105-176 aa

PF15346ARGLU114-268 aa

PF13685Fe-ADH_2205-220 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G094280	`PF15346`	ARGLU	90	106	3.1e-41	141.5
TkA02G094280	`PF13685`	Fe-ADH_2	105	176	7.7	7.2
TkA02G094280	`PF15346`	ARGLU	114	268	3.1e-41	141.5
TkA02G094280	`PF13685`	Fe-ADH_2	205	220	7.7	7.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card