LXL04_016904 | RubberDandelionOmics

Gene overview

LXL04_016904

Reference: OH-1004 Chr: Chr03 Coordinates: 136424605-136428239 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

771 bp · LXL04_016904|LXL04_016904|OH1004|cDNA

ATGGCTCGAGATAGGGAATTATCTCGGTCGCCGTCGTATAAAAGGCGGAGGCATTCAAGGTCACCTTCGCCGGTGATACACAGGAATAGTAGCCGAAGATACAGAAGCCGAAGAGATAGAAGCAGCAGATCTCCTTATTCTTATAGCAGAAGGAGAAGTCGTTCACCAACTCCAAGGAGACATAAGAGACAAAAAAGTAGAAGTACCTCCTTGTCTCCTATACCTAAGTCTCCCAAAATTGTCACTGAAAAAACGAaaat...

CDS

Download CDS FASTA

771 bp · LXL04_016904|LXL04_016904|OH1004|CDS

ATGGCTCGAGATAGGGAATTATCTCGGTCGCCGTCGTATAAAAGGCGGAGGCATTCAAGGTCACCTTCGCCGGTGATACACAGGAATAGTAGCCGAAGATACAGAAGCCGAAGAGATAGAAGCAGCAGATCTCCTTATTCTTATAGCAGAAGGAGAAGTCGTTCACCAACTCCAAGGAGACATAAGAGACAAAAAAGTAGAAGTACCTCCTTGTCTCCTATACCTAAGTCTCCCAAAATTGTCACTGAAAAAACGAAAAT...

Protein

Download Protein FASTA

256 aa · LXL04_016904|LXL04_016904|OH1004|PROTEIN

MARDRELSRSPSYKRRRHSRSPSPVIHRNSSRRYRSRRDRSSRSPYSYSRRRSRSPTPRRHKRQKSRSTSLSPIPKSPKIVTEKTKIEEEEQKKRRQREAELKLLEEETARRVEEAIMKKVEERLSCEEIKMEIKKRVEEGRKKVVRDVAQQLEKEKEAAVIEAKRKEEQARKEKEELERLVEENRKRVEEAQRREAMEQQRREEERYRELEQLQRQNEEALLRKKQQEEEERAKQQKLLGKNKSRPKLSFAIGSK

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_016904`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_016904

Location Chr03:136424605-136428239 (+)

Description Similar to At1g10890: Uncharacterized protein At1g10890

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g10890`	Uncharacterized protein At1g10890.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_016904 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0000381 regulation of alternative mRNA splicing, via spliceosome Biological Process

GO:0006397 mRNA processing Biological Process

GO:0008380 RNA splicing Biological Process

GO:0005634 nucleus Cellular Component

GO:0005654 nucleoplasm Cellular Component

GO:0005694 chromosome Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0016607 nuclear speck Cellular Component

GO:0003713 transcription coactivator activity Molecular Function

GO:0036002 pre-mRNA binding Molecular Function

GO:1990446 U1 snRNP binding Molecular Function

KEGG gene cross-reference

ath:AT1G10890

dme:Dmel_CG31712

dre:393131

dre:406834

rno:290912

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.927

Rank 1 · LXL04_016904 · OH-1004

Cytoplasm0.156

Rank 2 · LXL04_016904 · OH-1004

Cell membrane0.027

Rank 3 · LXL04_016904 · OH-1004

Mitochondrion0.018

Rank 4 · LXL04_016904 · OH-1004

Endoplasmic reticulum0.007

Rank 5 · LXL04_016904 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF15346.12ARGLU98-252 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_016904	`PF15346.12`	ARGLU	98	252	1.7e-40	139.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`P0CB26`	Arabidopsis thaliana	Uncharacterized protein At1g10890	62.903%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card