TkA02G091500 | RubberDandelionOmics

Gene overview

TkA02G091500

Reference: TK1151 Chr: Chr02 Coordinates: 23833259-23836347 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1608 bp · TkA02G091500|TK1151|cDNA

ACGTCAACGACAAATGAAAAGATTCGAAAGACAGCTCAACGCAAAACGGGGGGCAAAAAGTGATCTTCCACATGAAGAAAACCCTAATAATGGAAAATTAGAAGCAACGAGAAGAACCTGCACTTCGATTCCTTTCTCAATCTCTGCTTCAATGTAAATCTCATTTCATTTCAAGATCTTCACTGCATAAAAAAACAGGATTTCTGATTTGAATATGGCAAACTCAAGAGGTCCATCAACAACAACACCAAGAAACATGA...

CDS

Download CDS FASTA

723 bp · TkA02G091500|TK1151|CDS

ATGGCAAACTCAAGAGGTCCATCAACAACAACACCAAGAAACATGATGTACAATGGAAGTGGAAGACACTCTTTACTCCCCCCAAAATGTCCATTTCCAACTATTCCTCCATCATATTCTGATTACCTCTCAAATCCCACAATTCCCCCAAAAGGAATACCTAAATACAGAGACATAAACTCACACCATCAACGTGCTTCATCTGAAAGCCTTCTAATTGAAGAACAACCTTCATGGCTTGATGAACTTCTTAATGAACC...

Protein

Download Protein FASTA

240 aa · TkA02G091500|TK1151|PROTEIN

MANSRGPSTTTPRNMMYNGSGRHSLLPPKCPFPTIPPSYSDYLSNPTIPPKGIPKYRDINSHHQRASSESLLIEEQPSWLDELLNEPETPVQRGHRRASSDSFTYLEAANAANSNVEYGVQKDEHKLRNLTNIPSWGSQDFDFYKDGRTTSTPNHLINPNLKSRAWDSLQNRENFGLQRSVSLGASNDLRGIASTIRKNKMEVNWAHKIYLKMALKMQIMKEKILLIQNVPNSNLLNVQG

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G091500`
TK1151 ID	TkA02G091500
OH-1004 ID	LXL04_016933
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	98.500
Protein coverage (%)	TK1151 83.333 / OH-1004 40.900 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G091500

Location Chr02:23833259-23836347 (+)

Description Similar to At4g06598: Uncharacterized protein At4g06598

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g06598`	Uncharacterized protein At4g06598.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_016933 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0009555 pollen development Biological Process

GO:0045893 positive regulation of DNA-templated transcription Biological Process

GO:0005634 nucleus Cellular Component

GO:0000976 transcription cis-regulatory region binding Molecular Function

GO:0003677 DNA binding Molecular Function

GO:0003700 DNA-binding transcription factor activity Molecular Function

KEGG gene cross-reference

ath:AT2G42380

ath:AT3G58120

ath:AT4G06598

dosa:Os01g0211800

dosa:Os02g0247100

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.505

Rank 1 · TkA02G091500 · TK1151

Cytoplasm0.445

Rank 2 · TkA02G091500 · TK1151

Cell membrane0.111

Rank 3 · TkA02G091500 · TK1151

Endoplasmic reticulum0.082

Rank 4 · TkA02G091500 · TK1151

Mitochondrion0.043

Rank 5 · TkA02G091500 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

No result was found for this query.

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8W3M7`	Arabidopsis thaliana	sp\|Q8W3M7\|Y4598_ARATH Uncharacterized protein At4g06598	40.100%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card