RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkA02G091280
Reference: TK1151 Chr: Chr02 Coordinates: 23761024-23764579 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

1836 bp · TkA02G091280|TK1151|cDNA

CTTATCAGAACTTATTGGGAACACGTGGTGTGGAACTTTTGTGTCAAGCCACCCAGCTCCCAGTACCATTCTACCATTCCACACTCTCTCTCTCTCTCTCTCTCTCTCTCTCCAAGCTCCATCAATGGCGAAGCAACGATCTTCTTCGCTATTCTTCTCTTCACTATTAACCCCGAGAGGCGACACCCTTCTCTACCTCATCGCTCTCCTCTCGATCTTCTCTCTCGTACTCCACCACATCTCCCTCTCCGCCGCCGCCG...

CDS

Download CDS FASTA

1260 bp · TkA02G091280|TK1151|CDS

ATGACGAAGTTGAACTCGATGACGACTCTCTTTCATTCCAATCTTCCATCTCTGATCCCCCGCCGCTCCCCTCCTCCTTCCACCACTCTATCTACACCTTCCGATCCCGAATCTCACCATGGCCCACCTAGCCCACCCTCCTCCCAGCCGGCGGATTCCGATCTCCCAACCAAACCCTCAACCTCATCGTCTTCATTTGATTATTGGGATGAAGATGAGTTTGAAGGCTTTCCTACGGAAATAACATCCCCTGAAGTCTC...

Protein

Download Protein FASTA

419 aa · TkA02G091280|TK1151|PROTEIN

MTKLNSMTTLFHSNLPSLIPRRSPPPSTTLSTPSDPESHHGPPSPPSSQPADSDLPTKPSTSSSSFDYWDEDEFEGFPTEITSPEVSKVNEPTTPAGSESADVDDAETIAQPTSTKKTIGSFTVEIISVSILIVFAINYFTGKKENETLALAWAAKFATNDSIFEKNFSLLGVGETEDSPLLLKEGQNVFKFYASGRRFCQGLLATMELKSRHDLIARLYNMIVPCKDEITFEVYMNDDAMDHVVFALAKKKAAKAMQKE...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkA02G091280
TK1151 IDTkA02G091280
OH-1004 IDLXL04_016941
Relationship / confidenceMulti Source To Oh1004 / Complex relationship
Protein identity (%)97.800
Protein coverage (%)TK1151 95.465 / OH-1004 79.167
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkA02G091280
LocationChr02:23761024-23764579 (-)
DescriptionSimilar to At5g49945: Uncharacterized protein At5g49945
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At5g49945 Uncharacterized protein At5g49945. No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_016941 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)
GO:0006983 ER overload response Biological Process
GO:0007029 endoplasmic reticulum organization Biological Process
GO:0009791 post-embryonic development Biological Process
GO:0032469 endoplasmic reticulum calcium ion homeostasis Biological Process
GO:0036503 ERAD pathway Biological Process
GO:0045048 protein insertion into ER membrane Biological Process
GO:0055074 calcium ion homeostasis Biological Process
GO:0160063 multi-pass transmembrane protein insertion into ER membrane Biological Process
GO:0005783 endoplasmic reticulum Cellular Component
GO:0005789 endoplasmic reticulum membrane Cellular Component
GO:0005791 rough endoplasmic reticulum Cellular Component
GO:0016020 membrane Cellular Component
KEGG gene cross-reference
ath:AT5G49945
bta:540167
hsa:57003
mmu:67163
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.747
Rank 1 · TkA02G091280 · TK1151
Mitochondrion0.097
Rank 2 · TkA02G091280 · TK1151
Endoplasmic reticulum0.091
Rank 3 · TkA02G091280 · TK1151
Nucleus0.063
Rank 4 · TkA02G091280 · TK1151
Cytoplasm0.057
Rank 5 · TkA02G091280 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF07946CCDC47121-416 aa
PF12279DUF3619129-149 aa
PF12279DUF3619380-414 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
TkA02G091280PF07946CCDC471214162.2e-74251.3
TkA02G091280PF12279DUF36191291490.4411.7
TkA02G091280PF12279DUF36193804140.4411.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
Q94CC0Arabidopsis thalianasp|Q94CC0|Y5994_ARATH Uncharacterized protein At5g4994563.900%Swiss-ProtHigh

JBrowse

View in Genome Browser