TkA02G090600 | RubberDandelionOmics

Gene overview

TkA02G090600

Reference: TK1151 Chr: Chr02 Coordinates: 23528749-23532418 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2000 bp · TkA02G090600|TK1151|cDNA

CAACTATCCAAAAAAGGATCATGCCTGGATTTTGTGCCTGCTACTTGTTCAAGCCAACACATGTCTTTTTTTTCTCTTACTTTTAAGCCGGGGGGCTAATTGGGGCCGAAGTCGGTTATGATATTTCGTCAAAAGAAATGGCGCTTAAGCTTCCAGCCGATGGAGTTCCAGATGTCGCGTTTCAGTCGATTGGATGTGGTTACGATATCTCGCTAGATCTGAAGCTTAAGTATTGCAAAGGTGCTGATTTTGGTACTAAT...

CDS

Download CDS FASTA

1005 bp · TkA02G090600|TK1151|CDS

ATGGCGCTTAAGCTTCCAGCCGATGGAGTTCCAGATGTCGCGTTTCAGTCGATTGGATGTGGTTACGATATCTCGCTAGATCTGAAGCTTAAGTATTGCAAAGGTGCTGATTTTGGTACTAATCCATATCGAATGTGCCGTTTGATCGAAATGGACGAGGATGAAGGTAGAGACATTATGCTTCCTGGCGGGATTCTAATCATGAATGTTCCTGAATCCATCAAATGTGATAAAGGCGAACATATTCGATTTCAGTCTGG...

Protein

Download Protein FASTA

334 aa · TkA02G090600|TK1151|PROTEIN

MALKLPADGVPDVAFQSIGCGYDISLDLKLKYCKGADFGTNPYRMCRLIEMDEDEGRDIMLPGGILIMNVPESIKCDKGEHIRFQSGALSFQQMSEQFNRELSLDGNIPSGHFNSMFEFSGNWQKDASITKTLALDGVSISLYNIALEKSRILLCDYVKSDVPSSWDPPLLTRFIEKYGTHIIVGVKVGGKDVKCVKQDRGSSVEPADVEELLKKLADKRFLDSGHIPENDMLEGVKITRGGGSSARNLKHSEWLRSIQS...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G090600`
TK1151 ID	TkA02G090600
OH-1004 ID	LXL04_016952
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	84.800
Protein coverage (%)	TK1151 99.102 / OH-1004 59.930 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G090600

Location Chr02:23528749-23532418 (+)

Description Similar to At4g24290: MACPF domain-containing protein At4g24290

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g24290`	Negatively controls the salicylic acid (SA)-mediated pathway of programmed cell death in plant immunity.	No verified direct reference in this release
`At1g28380`	Negatively controls the salicylic acid (SA)-mediated pathway of programmed cell death in plant immunity.	Loss of Necrotic Spotted Lesions 1 associates with cell death and defense responses in Arabidopsis thaliana.2006 · DOI: 10.1007/s11103-006-9001-6
`At1g14780`	Negatively controls the salicylic acid (SA)-mediated pathway of programmed cell death in plant immunity.	No verified direct reference in this release
`At1g29690`	Negatively controls the salicylic acid (SA)-mediated pathway of programmed cell death in plant immunity.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_016952 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006955 immune response Biological Process

GO:0009626 plant-type hypersensitive response Biological Process

GO:0009651 response to salt stress Biological Process

GO:0010337 regulation of salicylic acid metabolic process Biological Process

GO:0012501 programmed cell death Biological Process

GO:0052542 defense response by callose deposition Biological Process

GO:0072708 response to sorbitol Biological Process

GO:2000031 regulation of salicylic acid mediated signaling pathway Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005886 plasma membrane Cellular Component

KEGG gene cross-reference

ath:AT1G14780

ath:AT1G28380

ath:AT1G29690

ath:AT4G24290

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.331

Rank 1 · TkA02G090600 · TK1151

Cell membrane0.218

Rank 2 · TkA02G090600 · TK1151

Nucleus0.188

Rank 3 · TkA02G090600 · TK1151

Extracellular0.183

Rank 4 · TkA02G090600 · TK1151

Endoplasmic reticulum0.076

Rank 5 · TkA02G090600 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01823MACPF16-210 aa

PF01823MACPF238-298 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G090600	`PF01823`	MACPF	16	210	9.8e-30	104.8
TkA02G090600	`PF01823`	MACPF	238	298	9.8e-30	104.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9STW5`	Arabidopsis thaliana	sp\|Q9STW5\|MACP2_ARATH MACPF domain-containing protein At4g24290	55.500%	Swiss-Prot	High
`Q9SGN6`	Arabidopsis thaliana	sp\|Q9SGN6\|NSL1_ARATH MACPF domain-containing protein NSL1	46.400%	Swiss-Prot	Medium
`Q8L612`	Arabidopsis thaliana	sp\|Q8L612\|MACP1_ARATH MACPF domain-containing protein At1g14780	40.800%	Swiss-Prot	Medium
`Q9C7N2`	Arabidopsis thaliana	sp\|Q9C7N2\|CAD1_ARATH MACPF domain-containing protein CAD1	40.100%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card